footjo




FC2SANADNVEMAAWDDASDSSISDTTMILKMARAMEYDMIAAROYDAMBIVENUFSDSSGVHKBIAUKSNACXNATR

2020-09-26
120 min

[JJDA-010]Fondled By A Lewd Brother-in-law... Yuka Hoshi

  • yuka hoshi censoredcreampiebig titsJJDAmature woman college real mature womanhirokoji osakimanji groupJJDA-010JJDA010jjda00010
    • 2020-10-03
    149 min

    [SSNI-887]Fresh Face NO.1 STYLE - Hana Arisu AV Debut

  • arisu aka censoredbig titsbeautiful girlSSNIs1 no 1 stylemon cSSNI-887SSNI887ssni00887
    • 2020-10-13
    108 min

    SMUK-029 Kurumi

  • amateur censoredschoolgirlamateursmuksmuk-029smuk029smuk-029
    • 2020-10-13
    24 min

    FC2PPV 1533048 Limited to 3 days [Individual] Debt collateral and mental collapse. I can not resist and it is vaginal cum shot in front of my husband

  • amateur uncensoredfc2
    • 2020-10-22
    159 min

    [NTRD-083]Cuckolders: A Story About A Wife's Adultery With A Junior At The Company - Kanna Shinozaki

  • kina shinozaki censoredmature womansingle workNTRDtakara eizokouji takarashintokaiNTRD-083NTRD08318ntrd00083
    • 2020-10-22
    140 min

    [MILK-091]Bottoms Up For 9 Hours - Tipsy, Dazed Orgasmic Sex Until Dawn Riona Minami

  • rina minami censoredbeautiful girlsingle workMILKmilkno directorMILK-091MILK091h-1240milk00091
    • 2020-10-31
    57 min

    [NYH-047]Sex With My Busty Stepdaughter At An Outdoor Hot Spring Ruka Inaba

  • ruka inaba censoredNYHdirectorsdirectorsnyanjiang houseNYH-047NYH0471nyh00047
    • 2020-11-11
    47 min

    279UTSU-469 Kanon

  • amateur censoredcreampiemarried womanutsuutsu-469utsu469279utsu-469
    • 2020-11-13
    239 min

    [SOUD-015]10 Sexy Amateur Sluts Go Absolutely Wild! Their Sensitive Pussies Clenching In Ecstasy Over Endless Orgasms As They Take Creampie After Creampie!

  • censoredcreampieamateurSOUDprestigebest fuckingSOUD-015SOUD015118soud00015
    • 2020-11-25
    54 min

    FC2PPV 1583493 [Personal shooting / set sale] 33-year-old married woman with well-trained physical beauty and erotic beauty Complete version

  • amateur uncensoredfc2
    • 2020-12-10
    102 min

    [SPRD-1356]Forgive Me... I Want My Son-In-Law's Babies Iroha Fukuyama

  • fukuyama iroha censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1356SPRD135618sprd01356
    • 2020-12-11
    261 min

    [BAZX-264]A Sex-Starved Married Woman Awakened Her Sexual Instinct And Used Her Exquisitely Big Tits As A Weapon As She Exploded With Passion And Lust! 2

  • censoredcreampiebig titsBAZXbazookatetBAZX-264BAZX264h-1496bazx00264
    • 2020-12-12
    86 min

    FC2PPV 1603181 [Eh, a beautiful wife NTR pole who takes her body! I will expose it without a face w] When I forcibly invited the mother of the child actor, it was insanely erotic, so I made a vaginal cum shot and seeded NTR. I wonder if it’s a p

  • amateur uncensoredfc2
    • 2020-12-25
    32 min

    [CLO-111]Masochism Tits, Sucking Dry - Chie Nakamura

  • tomoe nakamura censoredbig titshandjobCLOchobitchchovicCLO-111CLO111h-1435clo00111
    • 2021-01-18
    67 min

    IDJS-032 Tomomi

  • amateur censoredamateuridjsidjs-032idjs032idjs-032
    • 2021-01-30
    152 min

    [MIAA-383]When All Is Said And Done, I Love My Wife! Our Marriage Hit The Rocks, But When We Had Sex For The First Time In Years... Our Bodies Fit Like A Hand In A Glove, And We Fucked Like Crazy, Over And Over, Until The Break Of Dawn!! Kurea Hasumi

  • hasumi claire censoredcreampieblowjobMIAAmoodyzsapporo taroeveryone s porn starMIAA-383MIAA383miaa00383
    • 2021-02-06
    150 min

    [SSNI-988]They Hooked Up Online - Secret Tryst Between A Slutty S********l And An Older Guy Obsessed With School Uniforms Sayaka Otoshiro

  • otoshiro sayaka censoredschoolgirlbeautiful girlSSNIs1 no 1 stylefamSSNI-988SSNI988ssni00988
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-27
    76 min

    230OREC-703 Mao

  • amateur censoredcreampiebig titsorecorec-703orec703230orec-703
    • 2021-02-27

    H0930 ki210227 piddle 20years old

  • amateur uncensoredh0930
    • 2021-03-11
    93 min

    [OKB-107]Big Booty Voluptuous Babe In Nut-Busting Panties - Mako Shion - Chubby, Cute, Barely Legal Beautiful Teen In Tight Sports Briefs And A Track Suit, With Camel Toe And Wet, Horny Slit Plus Hairy Hoe Totally Exposed In Extreme Close-Ups! Plus A

  • miko shion censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-107OKB1071okb00107
    • 2021-03-11
    161 min

    [MIST-330]Private Titty Bar After Her Store Closed Down One Of The Women Contacted Me And Asked To Meet For Money...She Let Me Touch Her Tits And Cum Inside Of Her As Long As The Store Didn't Find Out! Sana Sanada

  • sanada sanada censoredbig titsMISTmr michirusaitaMIST-330MIST3301mist00330
    • 2021-03-18
    477 min

    [OFJE-304]Gorgeous Big Tits Bouncing All Over The Place! All G-Cup And Bigger Actresses Ride Dick Until They Cum 50 Rounds

  • arisu aka jun jun censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-304OFJE304ofje00304
    • 2021-03-18
    149 min

    [BLK-490]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 04

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-490BLK490blk00490
    • 2021-03-29
    67 min

    491TKWA-075 Pink Pocchi Nipple Neat Slender Girl And Uniform Again Rich SEX

  • amateur censoreduniformamateurtkwatkwa-075tkwa075491tkwa-075
    • 2021-04-13
    51 min

    499NDH-013 Men’s esthetician who spins huge breasts like a rampage cow! Refresh your body and soul with a vaginal pressure esthetic by a plump fair-skinned erotic BODY practitioner who is comfortable to hold! !! [Is it okay to have the mask remo

  • amateur censoredbig titsamateurndhndh-013ndh013499ndh-013
    • 2021-04-14
    119 min

    [OKSN-329]New Discovery! Adorable Pale-Skinned Beauty Can't Resist Her Lust For Her Lover - Drowning In Forbidden, Adulterous Passions

  • censoredbeautiful girlOKSNabc mousouzokuokaasan.com abc daydream familyOKSN-329OKSN329oksn00329
    • 2021-04-15
    83 min

    [REBD-550]Momo: Peach-colored First Love/Momo Honda

  • honda peach censoredsingle workREBDrebeccachikara sawamuraREBD-550REBD550h-346rebd00550
    • 2021-04-23
    61 min

    Caribbeancom 042321-001 Look At Me having SEX! and Jerk Off On My Face! 3 Rena

  • rena uncensoredcreampiehandjobcaribbeancom
    • 2021-05-08
    119 min

    [USBA-026]Aphrodisiac BDSM Becoming A Captive Of Pleasure Hell With Powerful Aphrodisiacs and Bukkake Nene Tanaka

  • nene tanaka censoredbig titssingle workUSBAavs collector ssaburo hiumaavscollector sUSBA-026USBA026usba00026
    • 2021-05-17
    77 min

    259LUXU-1394 Luxury TV 1405 Big Breasts Gravure Who Was Fascinated By Having Sex While Being Taken In The Last Shooting And Playing Only In AV Is Re-Appearing! !! Unleashed from her tension, she is enthusiastic about blaming herself this time. She le

  • amateur censoredbig titsamateurluxuluxu-1394luxu1394259luxu-1394
    • 2021-06-10
    124 min

    [FSDSS-233]Devilish Y********l Who Loves Older Men Controls Their Ejaculations At Her Whim No Matter How Many Times She's Already Made Them Cum Hiyori Yoshioka

  • hiyori yoshioka censoredbeautiful girlhandjobFSDSSfalenopenisonicfaleno starFSDSS-233FSDSS2331fsdss00233
    • 2021-06-22
    73 min

    300MAAN-667 [Baby Face x Big Breasts / Brain Iki x Vagina Iki / Massive Squirting & Cum Shrimp Warp] H Cup De M Daughter Brought Up By Nature! Izakaya clerk / no hand masturbation who came to have sex from Yamanashi for 3 hours one way! ？？ Toro sq

  • amateur censoredbig titssquirtingmaanmaan-667maan667300maan-667
    • 2021-06-26
    50 min

    Pacopacomama 062621_495 This is My Rule, Just Enjoy Deep Throating! Sakura Kazuki

  • amateur uncensoredpacopacomama
    • 2021-07-02
    58 min

    230OREC-817 Sarina

  • amateur censoredcreampieamateurorecorec-817orec817230orec-817
    • 2021-07-22
    59 min

    H4610 ki210722 Haruka Yumeno 23years old

  • amateur uncensoredh4610
    • 2021-07-29
    121 min

    [TOEN-046]Sexually Frustrated Stepmom Becomes Addicted To Sex With Her Stud Stepson During The Three Days Her Husband Is Out Of The House And They Fuck Day And Night For 72 Hours Straight Tsubaki Kato

  • kato camellia censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-046TOEN046h-086toen00046
    • 2021-08-04
    134 min

    [GVH-271]Plain Jane With Big Boobs And Glasses Rina Takase

  • rina takase censoredcreampiebig titsGVHglory questyumeno aidaGVH-271GVH27113gvh00271
    • 2021-08-04
    78 min

    FC2PPV 1954692 Hello! Project Honwaka Jd With One Experienced Person. Even Though I Have A Boyfriend, The First Vaginal Cum Shot Sex In My Life!

  • amateur uncensoredfc2
    • 2021-08-14
    120 min

    [KSBJ-153]A Strange Family Relationship Honoka Kimura

  • honoka kimura censoredcreampiemature womanKSBJksb kikaku emmanuellesakura ninKSBJ-153KSBJ153ksbj00153
    • 2021-08-17
    44 min

    H0930 ki210817 Yukino Kitayama 40years old

  • amateur uncensoredh0930
    • 2021-08-20
    51 min

    FC2PPV 2052614 * Weekend Limited 6000⇒3980 ★ First Shot ☆ Miraculous Thirty Beauty ♥ Former Race Queen ♥ Gokubi Body Towako 32 Years Old ♥ Exciting! Continuous Iki ♥ De M Irama’S Drooling Lust ♥ Excited Mass Cum Shot ♥ * 2 Consecutive Blowjobs W

  • amateur uncensoredfc2
    • 2021-09-11
    121 min

    [LUNS-082]Sixty Something Grandmother And Step Grandson 6

  • censoredcreampiebig titsLUNSluna shunkoushaLUNS-082LUNS082luns00082
    • 2021-09-13
    58 min

    328HMDN-407 [Individual, 60th Road] Big Breasts Sexual Intercourse With G Cup Mother’s Sister. Gonzo Out Her Aunt Who Had Been Getting Nui From The Dc Era

  • amateur censoredcreampiemarried womanhmdnhmdn-407hmdn407328hmdn-407
    • 2021-09-23
    113 min

    [IENF-167]You"ll Be Able To Clearly See Everything, Even Down To The Number Of Anal Wrinkles On Her Ass! No Mosaic Censoring A Consecutive Orgasmic Anal Masturbation Show-Off 4

  • miyazaki rin jinno hina censoredanalIENFie nergyienfIENF-167IENF1671ienf00167
    • 2021-09-24
    194 min

    [HUNTB-104](You Helped Me Study, So I"ll Teach You Naughty Things) A Private Lesson With Strings Attached Between My Step-Sister, A Whore Whose Grades Are Dropping Like A Rock, And Me, A Virgin And A Nerd

  • maiko kobayashi shinshiro censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-104HUNTB104huntb00104
    • 2021-09-25
    96 min

    521MGFX-026 Charismatic Big Tits Married Woman Soap Lady

  • amateur censoredbig titsmarried womanmgfxmgfx-026mgfx026521mgfx-026
    • 2021-10-08
    47 min

    FC2PPV 2315051 She Loves To Be A Ya-Like [Bride Education]! Man Juice Lotion Leaks, Chestnuts And Pussy Completely Crash With Unequaled Dick

  • amateur uncensoredfc2



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies