dmm exclusive




FC2EBODJUFESQTEAWDMIDVSSNIGMEMADNPREDHMNFSDSSBBANHNDATIDSSISABWNGODHZGDIPXHODV

2024-02-16
100 min

MUDR-250 Water Honey Girl 1 & 2 A Boring Middle-aged Teacher With Creepy Glasses Sleep-rapes A Beautiful Girl With Big Breasts In A Uniform. Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsMUDRinnocentMUDR-250MUDR250mudr00250
    • 2024-02-16
    110 min

    EBWH-077 A Real Athlete With A History Of National Tournament MVP Hidden Big Breasts Nadeshiko Goalkeeper Neo Hinasaka AV Released

  • neo hinasaka censoredbig titsEBWHe bodylamb chopEBWH-077EBWH077ebwh00077
    • 2024-02-16
    120 min

    KAM-175 A Leaked Video Taken By The Owner Of A Long-established Inn In The Kanto Area. Sleeping Pills Aimed At A Beautiful Wife On A Women"s Group Comfort Trip. Creampie Rape Video 3. A Drink Was Placed In The Room Of The Inn Where She Was Stayin

  • naoko yokoyama censoredcreampiebig titsKAMkarmagroupKAM-175KAM175kam00175
    • 2024-02-16
    150 min

    JUNY-109 A Super Plump J-type Girl With Huge Breasts Is Full Of Pacifiers. She Storms Into A Middle-aged Teacher"s House And Fucks Her As Much As She Wants During Her Summer Vacation. Reo Fujisawa

  • reo fujisawa censoredbig titsschoolgirlJUNYfitchkoenji goronikuyokuJUNY-109JUNY109juny00109
    • 2024-02-16
    120 min

    KAM-177 Sexually Harassed At Her Husband"s Boss"s Promotion Party - NTR Married Woman"s Home Party - A Beautiful Big Tits And Ass Wife Gets Drunk And Fucked In Full Throat - Mizuki Yayoi

  • mizuki yayoi censoredcreampiebig titsKAMkarmagroupKAM-177KAM177kam00177
    • 2024-02-16
    190 min

    HJMO-637 Limited To Lovey-dovey Newlywed Couples. Fixed Vibrator Hand-holding Immoral NTR Game. How Much Pleasure Can A Wife Endure While Holding Her Husband"s Hand Through The Wall？ ？ If You Feel It, It"s An Immediate Punishment Game!

  • censoredHJMOfirst planHJMO-637HJMO637hjmo00637
    • 2024-02-16
    120 min

    PRED-560 While My Wife And I Were Bored, I Was Seduced By Ai (my Sister-in-law) And Ended Up Ejaculating Over And Over Again... Ai Takashima

  • takashima ai censoredcreampiePREDpremiumsapporo taroelegancePRED-560PRED560pred00560
    • 2024-02-16
    140 min

    MIH-004 Isn"t It Lame That She Doesn"t Do Sex Work Even Though She"s An AV Actress？ ？ Charge! A Serious Infiltration Report At A Rumored Sex Shop! Soap! M Sexual Feeling! Reverse Bunny! If You Can Endure The Amazing Technical Coverage At

  • ichika matsumoto censoredcreampieMIHbookthere is alsomatsumoto ichikaMIH-004MIH004mih00004
    • 2024-02-16
    120 min

    PPPE-193 A Reversal Of Positions And A Compliant Pet. I Made My Cheeky Big-boobed Older Sister Who Makes Fun Of Me Understand By Humiliating Her With An Obscene Costume! Aiho Suzu

  • aiho ti censoredcreampiebig titsPPPEoppaiPPPE-193PPPE193pppe00193
    • 2024-02-16
    120 min

    MIAB-110 Every Day, I Peeked At My Older Brother Who Was Being Taught Kissing By A Female College Student Tutor And Was Steadily Improving...I (my Younger Sister) Also Started Kissing...Hikaru Minazuki

  • hikaru minazuki ayame miyakozaki censoredschoolgirlbeautiful girlMIABmoody ssapporo taroeveryone s kikatanMIAB-110MIAB110miab00110
    • 2024-02-16
    120 min

    MIDV-656 She Gets Excited By Her Older Sister Who Seduces Her Without A Bra And Turns Into A Sexual Monster! Even After Using Up One Box Of Condoms, Sakura Miura Continued To Fuck Even More.

  • minamata sakura otowa misuzu censoredbig titsbeautiful girlMIDVmoody swakatsukimoodyz divaMIDV-656MIDV656midv00656
    • 2024-02-16
    165 min

    DVMM-069 General Male And Female Monitoring AV Big Breasted Female College Student! Could You Please Wash Your Dick In The Men"s Bath With Just A Towel？ 3 Surrounded By The Fully Erect Penises Of Male Customers, I Feel Embarrassed As I Squeeze, S

  • censoredcreampiebig titsDVMMdeepskomatsu seventeendeep sDVMM-069DVMM069dvmm00069
    • 2024-02-16
    130 min

    MIDV-625 A Big-breasted H-cup Married Woman Has An Affair With A Male College Student For The Sake Of Her Seedless Husband. A Man And A Woman Who Have 20 Fucks With 3 Part-time Jobs A Week. Fumika Nakayama

  • nakayama fumika censoredcreampiebig titsMIDVmoody strendy yamaguchimoodyz divaMIDV-625MIDV625midv00625
    • 2024-02-16
    120 min

    MEYD-897 "Eh... Even If I Call Two People, This Is The Price...!？" I, Who Continued To Be Slut-slutted Until I Had A Hard Time With A Super Cheap BBA Delivery Health 3P Course, Nene Tanaka, Yuria Yoshine

  • nene tanaka yoshine yuria censoredbig titsmature womanMEYDtameike gorohiroharu osakiMEYD-897MEYD897meyd00897
    • 2024-02-16
    120 min

    MIDV-631 I"m Going To Make You Understand The Active Girl Who Doesn"t Have Any Desire To Deal With Salt! An Unparalleled Old Man"s Creampie Rape That Overflows With Sperm. Nana Misaki

  • misaki nana censoredcreampieuniformMIDVmoody shiroharu osakimoodyz divaMIDV-631MIDV631midv00631
    • 2024-02-16
    160 min

    PRWF-001 Real Married Woman AV Appearance Sumire (28 Years Old), An Elegant And Slightly Expensive-looking Big-breasted Wife Who Continues To Work As A Receptionist Even After Getting Married, Reveals Her True Nature With Other People"s Dicks

  • censoredbig titsPRWFpremiumhirose takasepremium wivesPRWF-001PRWF001prwf00001
    • 2024-02-16
    115 min

    DVMM-068 On A Business Trip To A Local Area For 2 Days And 1 Night...Reverse NTR In A Shared Room Mei Itsukaichi, A Beautiful New Office Lady With A Promising Future, Will Give You Energy For Tomorrow With Her Boss"s Unaccustomed Dirty Talk And F

  • itsukaichi mei censoredcreampieslutDVMMdeepsfunky haseideep sDVMM-068DVMM068dvmm00068
    • 2024-02-16
    170 min

    MEYD-888 Limit Squirting 4000ml & Longest Flying Distance Over 160cm! A Super Popular Prostitute AV Debut In Kansai That Has People Lining Up! Miren Aida

  • aida mire censoredsquirtingmature womanMEYDtameike gorohakushuMEYD-888MEYD888meyd00888
    • 2024-02-16
    170 min

    PRED-554 Riho Matsumoto, The Goddess Soap That Allows Unlimited Ejaculation, Continues To Serve You Politely And Thoroughly Even When The Lewd Older Sister Is Already Ejaculating.

  • matsumoto riho censoredcreampiePREDpremiumtrendy yamaguchielegancePRED-554PRED554pred00554
    • 2024-02-16
    120 min

    PRED-556 A Sex Development Massage For A Married Woman With Beautiful Legs Who Wants To Become Beautiful. Her Big Ass, Shaking Legs, And Convulsions Make Her Cum Over And Over Again. Shiramine Miu

  • shiramine miu censoredcreampiePREDpremiumcomet akaielegancePRED-556PRED556pred00556
    • 2024-02-16
    115 min

    MEYD-882 Club Activities Advisor Midsummer Training Camp Preview NTR Tsubasa Amami

  • amami tsubasa censoredbig titsmature womanMEYDtameike gorohiroharu osakiMEYD-882MEYD882meyd00882
    • 2024-02-16
    210 min

    HJMO-636 Specialized In Black Pantyhose That Are Damp On The Outside. A Shameful Game Where You Shake Your Hips With A Fixed Dildo. An Obstacle Race That Gradually Increases In Size And Makes You Cum In Agony! If You Can"t Reach The Goal Within T

  • censoredcreampieHJMOfirst plannagase wingHJMO-636HJMO636hjmo00636
    • 2024-02-16
    119 min

    MEYD-881 At My Son"s School Festival, The PTA President, Mr. Sayama, Gave Him An Extremely Naughty Sex Education! ! Sayama Love

  • sayama love censoredcreampiebig titsMEYDtameike gorotiger gavelMEYD-881MEYD881meyd00881
    • 2024-02-16
    140 min

    FPRE-012 I Was Stuck At Work And Got Hurt After Fighting With My Boyfriend... A Rainy Weekend With My Student Who Couldn"t Go Home And Her Instincts Led Us To Each Other"s Wet Bodies And Ejaculated Deep Inside Her Vagina Over And Over Again.

  • reina taoyua censoredcreampiebig titsFPREfitchtrendy yamaguchipreciousFPRE-012FPRE012fpre00012
    • 2024-02-16
    170 min

    MEYD-887 A 32-year-old Married Woman Looks Like A Pervert And Suddenly Makes Her AV Debut With Double-hole Anal Sex. Saeko Usui

  • saeko usui censoredanalmature womanMEYDtameike gorohakushuMEYD-887MEYD887meyd00887
    • 2024-02-16
    120 min

    PRED-557 Creampie Ban Lifted For The First Time In My Life! Premium Exclusive Decided S-class Slender Body Suddenly 10 Creampies Special Ichika Hoshimiya

  • ichika hoshimiya censoredcreampiePREDpremiumtrendy yamaguchielegancePRED-557PRED557pred00557
    • 2024-02-16
    130 min

    HJMO-635 Big Breasted Married Woman ONLY! Bra-less T-shirt Nipple Peeing Patience Game! Huge Dick Raw Fucking Punishment Game For Failing The Challenge!

  • censoredbig titsHJMOfirst plannagase wingHJMO-635HJMO635hjmo00635
    • 2024-02-16
    210 min

    PPPE-190 Returning To Okinawa From Tokyo With Sanshin! Hcup Big Breasted Islander Makes A Triumphant Return On The 3rd Anniversary Of Her AV Debut! Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPEoppaiPPPE-190PPPE190pppe00190
    • 2024-02-16
    120 min

    MVSD-591 I Lost My Mind Due To Her Innocent Smile And Devilish Seduction... A Beautiful Trainer Who Seduces A Middle-aged Man With Her Skillful Slutty Techniques And Naughty Waist Movements - Reverse NTR - Akari Neo

  • akari neo censoredcreampiebeautiful girlMVSDm s video groupasagiriMVSD-591MVSD591mvsd00591
    • 2024-02-16
    240 min

    MKCK-352 Creampie Intercourse 84 Times, With A Young Face And Big Breasts, Injecting A Lot Of Thick Sperm Into The Immature Body Of A Girl In Uniform

  • amatsuki azu yuria hafu censoredcreampiebig titsMKCKe bodyMKCK-352MKCK352mkck00352
    • 2024-02-16
    130 min

    EBWH-057 An Innocent Childhood Friend Reunited After 6 Years Turns Into A Bitch! ？ Azu Amazuki Couldn"t Stand Her Defenseless Big Butt And Fucked Her For 3 Days And 3 Nights Without Telling Her Family.

  • amatsuki azu censoredbig titsEBWHe bodyukichiEBWH-057EBWH057ebwh00057
    • 2024-02-16
    150 min

    PPPE-191 9 Hours After Dropping Off The Child At Nursery School. Riho Fujimori, A Sweaty Mama-chari Married Woman Who Was Sweaty During The Pick-up And Drop-off, Developed A Tendency To Ejaculate Prematurely And Fucked Her Repeatedly.

  • riho fujimori censoredbig titsPPPEoppaiPPPE-191PPPE191pppe00191
    • 2024-02-16
    150 min

    EBWH-064 Surrounded By Big-breasted Adventurers With Their Own Reasons And Problems, Enjoy Sex! ？ The Result Of Me, A Healer, Joining An All-female Party.The First Live-action Version Of The Parallel World Harem Manga! !

  • kashiwagi konatsu yuna mitake censoredcreampiebig titsEBWHe bodydazai chinpoEBWH-064EBWH064ebwh00064
    • 2024-02-16
    240 min

    MBYD-387 BEST 4 Hours Of 22 Married Women Who Were Made To Cum Due To An Unwanted Affair With An Unfaithful Middle-aged Man

  • censoredmature womanMBYDtameike goroMBYD-387MBYD387mbyd00387
    • 2024-02-16
    130 min

    EBWH-056 Yuki Nitta, A Quiet Person Who Fell Silently Into Pleasure As The Huge-breasted Molester Relentlessly Massaged, Played With, And Twisted Her Breasts.

  • nitta yuki censoredbig titsEBWHe bodyjacken kodamaEBWH-056EBWH056ebwh00056
    • 2024-02-16
    120 min

    MIAB-117 The Hidden Face Of A Female Teacher That Only I Knew. My Favorite Teacher, Naruisa, Was Being Deep-throated By Delinquents After School... Ruisa Tozuki

  • tsuzuki ruisa censoredMIABmoody sukichieveryone s kikatanMIAB-117MIAB117miab00117
    • 2024-02-16
    150 min

    EBWH-072 My Brother"s Wife"s Physical Beauty Is Too Attractive... Aphrodisiac Is Mixed With Protein And A Strong Woman"s Body Is Confirmed To Be Pregnant, Creampie Sex Maria Chihaya

  • chihaya maria censoredcreampiebig titsEBWHe bodytrendy yamaguchiEBWH-072EBWH072ebwh00072
    • 2024-02-15
    116 min

    300MIUM-1033 Shiatsu/breast Pressure Massage! [Gotanda Masseuse With An Amazing I Cup That Moves Slowly] Charming GOOD! Style GOOD! Sexual Desire Is Also Good! Her Huge Breasts Are Too Sensitive And She Cums A Lot!

  • amateur censoredcreampiebig titsmiummium-1033mium1033300mium-1033
    • 2024-02-15
    60 min

    200GANA-3000 Hidden Video Of Sex In The Sex Room Of A Seasoned Pick-up Artist 336 Secret Video Of A Girl Who Followed A Man To A Man"s House! A Fair-skinned Girl Who Seems Quiet And Pure! ! With A Deep Kiss And An Electric Massager, Her Pussy Get

  • amateur censoredamateurganagana-3000gana3000200gana-3000
    • 2024-02-14
    63 min

    259LUXU-1775 Luxury TV 1761 100 Pure And Neat! Active Female Voice Actor Appears In AV! Moe-like Moaning Voice Overflowing From A Body With Outstanding Sensitivity! An Appearance To Learn Acting Turns Into Facial Sex With Professional Techniques!

  • amateur censoredbig titsamateurluxuluxu-1775luxu1775259luxu-1775
    • 2024-02-13
    59 min

    SIRO-5215 A 26-year-old Older Sister Is So Nervous That Her Voice Is Shaking. When You Touch The Erogenous Zone To Relieve Tension, It Reacts Sensitively! In The End, I Was So Excited That I Forgot How Nervous I Was! [First Shoot] AV Application Onli

  • amateur censoredbig titsamateursirosiro-5215siro5215siro-5215
    • 2024-02-12
    73 min

    300NTK-856 [G Over-sized World-class Half-breasted Beauty! ! ] [Straight To Desire! ! It"s Erotic Because It"s Straight! ! Searching And Etching Big Breasted Girls! ! ] [Big Breasts! ! Raw Insertion Into The Squirting Pussy Of A Fair-skinned

  • amateur censoredcreampiebig titsntkntk-856ntk856300ntk-856
    • 2024-02-12
    60 min

    200GANA-2996 Seriously Soft, First Shot. 2014 Pick Up A 173cm Tall White Gal In Shibuya Who Cheerfully Says Anything Is Okay As Long As It Feels Good And Fun! Maximize Your Eroticism With Sexy Lingerie And Boots! But Surprisingly, She Also Has A Sens

  • amateur censoredamateurganagana-2996gana2996200gana-2996
    • 2024-02-11
    63 min

    SIRO-5201 A Beautiful Older Sister With A Cute Smile Applied For An AV Out Of Curiosity! She Plays With Her Frustrated Body And Squirts A Lot In Front Of The Camera! ! Once She Gets Used To It, She Takes Turns Attacking And Defending, Licking The Man

  • amateur censoredbig titssquirtingsirosiro-5201siro5201siro-5201
    • 2024-02-10
    63 min

    200GANA-2990 In The Sex Room Of A Seasoned Pick-up Artist, We Secretly Filmed Her For Sex 335 Take Home A Tall, Small-faced Girl With A Model Body! I Have A Sensitive Constitution That Makes Me Cum Right Away Even Though I Say "I"m Embarrasse

  • amateur censoredamateurganagana-2990gana2990200gana-2990
    • 2024-02-10
    240 min

    BAZX-389 After School, Uniform Girl Will Be Delivered To You. 01 Would You Like To Play Aoharu With Me？

  • censoredcreampieuniformBAZXbazookatodoBAZX-389BAZX389bazx00389
    • 2024-02-10
    242 min

    KTRA-610 Continuous SEX With Big Breasted Sisters! ! 4 Hours

  • satsuki mei jinguji temple nao censoredbig titsKTRAk tribeKTRA-610KTRA610ktra00610
    • 2024-02-10
    240 min

    SABA-882 Cute As A Celebrity! Become Friends With A Beautiful Girl And Do A Follow-up Investigation! Assortment Of Cute SEX! A Huge Resemblance To The National Idol! Facial Deviation Value Exceeds 70! She Has A Great Personality And Loves Naughty Thi

  • censoredcreampieuniformSABAclass s amateurtodoSABA-882SABA882saba00882



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies