z men




FC2FSDSSHMNVENUATIDMEYDSHKDMARAMIAAVEMASPRDSTARSAWDNACRSDABPPPDKSBJABWDTTSANMIDE

2021-03-12
160 min

[ZMEN-081]My Friend's Girlfriend Slipped Into My Bed During A Sleepover... 6 Unable To Resist The Pheremones From This Lusty Older Woman I Cover Her Mouth With Mine To Stifle The Sound Of Her Cumming As I Fuck Her Over And Over!

  • really aishin shinkawa censoredblowjobZMENz mennaveZMEN-081ZMEN081h-1371zmen00081
    • 2021-03-12
    243 min

    [UMSO-379]Secret Affair With Middle Aged Men POV Footage Of 10 Married Women Enjoying Fucking Around

  • censoredmarried womanamateurUMSOkm produceumanamiUMSO-379UMSO37984umso00379
    • 2021-03-07
    68 min

    FC2PPV 1715591 Experienced people over 3 digits ♥♥ I had my sister with a beautiful black hair body who got tired of one-on-one SEX play with men with unlimited number of ejaculations ♥♥

  • amateur uncensoredfc2
    • 2021-03-05
    170 min

    [ABW-062]Miss Suzumura Loves Teasing Men! My Teacher Miss Suzumura Lovingly Fucks Me Three Times In A Row! Airi Suzumura

  • suzumura airi censoredsquirtingblowjobABWprestigemichiru sunabsolutelyABW-062ABW062118abw00062
    • 2021-03-05
    50 min

    FC2PPV 1713275 [Reading notice] A cute female college student who is squeezed by three muscular men 2 ♀ Demon convulsions acme at the continuous cum beyond the limit w The best orgy experience video

  • amateur uncensoredfc2
    • 2021-03-05
    30 min

    [BTH-126]Girl Slurps Down 19 Loads Of Cum From Men She Doesn't Even Know! Maki Hoshikawa

  • maki hoshikawa censoredblowjobsingle workBTHchobitchsuper bitchBTH-126BTH126h-1435bth00126
    • 2021-03-03
    48 min

    FC2PPV 1709214 Men’s Esthetic Training Hidden Shooting (Kasumi 22 years old) -FBK for OPI stamp & TKB licking of slender beautiful breasts new therapist! Unbearably raw IN vaginal cum shot finish! !!

  • amateur uncensoredfc2
    • 2021-03-03
    150 min

    [PFES-003]Men's Massage Parlor With A Specialty In Panties Big Ass Face Sitting And Creampie Full Course! Akari Neo

  • akari neo censoredlingeriesingle workPFESwanz factorygoemonsummer panties festivalPFES-003PFES003pfes00003
    • 2021-03-01
    56 min

    FC2PPV 1668291 [Gachi Hidden Camera] Infiltrate the men’s esthetics rumored to be spoiled by Gotanda ❤️ Rubbing huge breasts with glasses type camera ❤️ Finally finish at missionary position

  • amateur uncensoredfc2
    • 2021-02-28
    145 min

    [KTKC-108]Miyu-pon Is A Karate Master Tuber Who Likes To Toy With Men's Hearts, Because She's A "Cunning And Erotic Bitch" She's A Black Belt, But Usually She's A Maso And Obedient Sex Pet And Now This Video Is Being Released

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-108KTKC108ktkc00108
    • 2021-02-28
    138 min

    [LBOY-061]She Might Look Plain, But Her Nipples Are Erect 365 Days A Year! - An Amateur Transsexual Woman With Sensitive Nipples Makes Her Porno Debut

  • censoredamateurLBOYladyacorn taroLBOY-061LBOY061lboy00061
    • 2021-02-27
    50 min

    FC2PPV 1703921 Testicle Massage ＃ 4 Misato Sakata [Tokyo Hands @ Men’s Esthetics]

  • amateur uncensoredfc2
    • 2021-02-27
    137 min

    [YAKO-024]This Oral Pussy Bitch With A Secret Account Has Been Posting Over 1000 Dick-Sucking Videos A Year, And It Turned Out That She Was A Tall And Beautiful Transsexual.

  • censoredanalYAKOmercuryshinjuku undergroundYAKO-024YAKO024h-1133yako00024
    • 2021-02-27
    154 min

    [CLUB-630]The Routine Of A Horny Married Woman Who Brings In Young Men And Seduces Them With Her Huge Breasts

  • censoredbig titsslutCLUBhentai shinshi clubCLUB-630CLUB630club00630
    • 2021-02-25
    179 min

    [HAWA-239]Young Wife Loves Old Men And Will Suck Anyone's Dick When She's Horny!!

  • censoredamateurblowjobHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-239HAWA2391hawa00239
    • 2021-02-22
    131 min

    [OPPW-085]Transsexual With Super Cute Voice And Osaka Dialect Has First Crossdressing Experience And AV Debut!! Chii Fuyutsuki

  • chii fuyutsuki censoredsingle workOPPWyourOPPW-085OPPW085oppw00085
    • 2021-02-22
    129 min

    [OPPW-086]I'm An Evolutionary Man Who Transformed Into A Girl, And Now I'm Better At Squirting Than Ejaculating Ai Sato

  • airi sato censoredsquirtingsingle workOPPWopenipeni world mousouzokukamon seijoiOPPW-086OPPW086oppw00086
    • 2021-02-22
    133 min

    [OPPW-087]She Tried Meeting Men Online And Went To Meet Them Ready To Fuck, But They All Turned Out To Be Perverts With Abnormal Fetishes, So, Feeling Unsatisfied, She Decided To Make Her Debut As An AV Porn Actress To Get Her Fill Of Sex! Kanade Asa

  • asahina kanade censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-087OPPW087oppw00087
    • 2021-02-22
    130 min

    [BTIS-111]Beautiful Crossdressing Prostitute 8 - Akari

  • censoredBTISbeautiful boy publishing.companykamon seijoicross dressing sexy boyBTIS-111BTIS111btis00111
    • 2021-02-22
    40 min

    FC2PPV 1697641 [Personal shooting, 4P, limited quantity 500pt off] The wife who was called during aerobic exercise at a sports gym. The sweaty body was whispered by the tongues of three men …

  • amateur uncensoredfc2
    • 2021-02-20
    88 min

    [KIR-028]Big Titty Saleswoman Gets Contracts Signed By Fucking Men Who Live Alone Naoko Akase

  • naoko akase censoredbig titsblowjobKIRstarkireiKIR-028KIR028h-254kir00028
    • 2021-02-19
    96 min

    [SUJI-129]Selfish S*****t Chiharu Is Men's Desire

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-129SUJI129suji00129
    • 2021-02-19
    61 min

    Caribbeancom 021921-001 NO LIMIT Four men in me

  • mika takagi uncensoredcreampiehandjobcaribbeancom
    • 2021-02-16
    61 min

    FC2PPV 1688871 First shot ❤️ After all, men like this kind of system the most. 【selfie】

  • amateur uncensoredfc2
    • 2021-02-13
    61 min

    Caribbeancom 021321-001 She loves to have sex with men who obsessed with her body Maki Koizumi

  • maki koizumi uncensoredcreampiecaribbeancom
    • 2021-02-13
    107 min

    [NSPS-967]New Bride Ravished By Other Men From Dawn Until Dusk On Her Honeymoon - Couple Taken Hostage Rei Reiwa

  • rei censoredmarried womandramaNSPSnagae styletaro fujoNSPS-967NSPS967nsps00967
    • 2021-02-12
    148 min

    [DASD-815]A Year Of Delinquency - Rui Nanase

  • nanase rui censoredcreampiebeautiful girlDASDdasnao masakiDASD-815DASD815dasd00815
    • 2021-02-12
    145 min

    [ZMEN-078]My Cousin Came To Stay Over, And She Was So Cute The Next Morning, She Was Wearing My Dress Shirt Without Her Bra On! 2

  • himari kinoshita himari hanazawa honoka wakamiya censoredblowjobZMENz mennabeZMEN-078ZMEN078h-1371zmen00078
    • 2021-02-12
    143 min

    [ZMEN-079]This Lady Boss Had A Vibrator Installed In Her Pantyhose By Her Employee, And She Desperately Tried Not To Cum, But The Aphrodisiacs And Piston-Pounding Thrusts Got Her To Start Shaking Her Ass In Complete Orgasmic Capitulation

  • really aishin shinkawa censoredslutZMENz mengoro koenjiZMEN-079ZMEN079h-1371zmen00079
    • 2021-02-12
    120 min

    [NATR-651]Betrayed By My Lovely Husband - Kaori Hirasei

  • hira kiyoka censoredcreampiesingle workNATRnadeshikoNATR-651NATR651h-067natr00651
    • 2021-02-12
    182 min

    [JUFE-259]Restraint Suit Room: Beautiful Sluts Who Restrain Men And Make Them Crazy - Maria Nagai, Eri Akira

  • maria nagai aki erie arai erie yuka osawa censoredslutJUFEfitchaida yumenoJUFE-259JUFE259jufe00259
    • 2021-02-11
    153 min

    [SPRD-1374]This World Exists For Men And Women Only After I Got Continuously Fucked By My Father-In-Law Yuri Tadokoro

  • yuri tadokoro censoredsingle workSPRDtakara eizokouji takaraaleddinSPRD-1374SPRD137418sprd01374
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    131 min

    [PIYO-104]Your Cousin Is A Blowjob Bitch! "You're The Reason Why I Like To Give Men A Blowjob So Much!" After Secretly Grooming Her To Suck Your Dick, Your Little Cousin Has Transformed Into A Blowjob Bitch, And Now She'll Keep On Suc

  • censoredcreampieschoolgirlPIYOhyokopiero dabicchiPIYO-104PIYO1041piyo00104
    • 2021-02-11
    56 min

    SIRO-4420 [First shot] [Tall x H cup x active JD] [Enchanted body that attracts men] A 21-year-old active university student who exposes a fascinating perfect body. Attract serious pant to the pleasure that becomes intense .. AV application on the ne

  • amateur censoredbig titsamateursirosiro-4420siro4420siro-4420
    • 2021-02-11
    146 min

    [SPRD-1376]This World Exists For Men And Women Only A Dirty Old Man Who Likes To Lick And A Horny Bride Nanako Takamiya

  • nanako takamiya censoredsingle workSPRDtakara eizokon oriharualeddinSPRD-1376SPRD137618sprd01376
    • 2021-02-10
    52 min

    FC2PPV 1680300 Unstoppable sexual desire] Duero married woman who is crowded with men on SNS 31-year-old mom with a child of dirt Completely fallen into direct sperm in 50 minutes

  • amateur uncensoredfc2
    • 2021-02-07
    149 min

    [DNJR-044]A Nympho Home Tutor Who Licks Men's Shameful Parts - Miori Saito

  • miori saito censoredblowjobslutDNJRdog daydreamersmaboroshikoDNJR-044DNJR044dnjr00044
    • 2021-02-07
    125 min

    [RPIN-047]She Only Wants To Be Fucked By Handsome Men! A Soft And Fluffy Bitch But She's Unable To Resist A Rock Hard Cock, And Started Drooling And Cumming...

  • censoredbig titsRPINlycopene mousouzokuRPIN-047RPIN047rpin00047
    • 2021-02-06
    24 min

    FC2PPV 1675088 [3P Real NTR] Husband is away from work During the day, a married woman brings in two men and ejaculates on a bed sleeping with another person’s cock and a beloved husband

  • amateur uncensoredfc2
    • 2021-01-31
    69 min

    300NTK-511 Ramen shop GAL that is too beautiful! !! Taste both men and chin! !! Ferateku has a sizzle feeling! ？？ Beautiful big breasts with pink nipples are breasts that can be lined up! !! The finest gal who wants to bend her beautiful body with ca

  • amateur censoredcreampiebig titsntkntk-511ntk511300ntk-511
    • 2021-01-31
    115 min

    [HERY-109]Cross-Dressers Fucked Like Bitches Collection 7 Ai Sato ri

  • airi sato censoredcreampiesingle workHERYyellow mousouzokudr fuyellowHERY-109HERY109hery00109
    • 2021-01-30
    150 min

    [JUFE-253]Dangerous Nipple Tweaking And Pull Out Action That Will Make Maso Men Melt Like Butter And Fire Off Unlimited Ejaculatory Orgasms Ai Mukai

  • ai mukai censoredslutsingle workJUFEfitchsamoariJUFE-253JUFE253jufe00253
    • 2021-01-30
    148 min

    [MIFD-146]She Loves To Mount Bikes And Men! She Loves To Fuck So Much That She Answered Our Ad, Just Out Of Curiosity A Super Horny Bucking Bronco-Riding Sexual Genius Makes Her Adult Video Debut!! Wakana Asamiya

  • wakana asamiya censoredsingle workMIFDmoodyzmichiru arashiyamamoodyz freshMIFD-146MIFD146mifd00146
    • 2021-01-28
    54 min

    FC2PPV 1663070 [Outstanding style] I have done 3P for the first time with a beautiful female college student and two old men ♥♥

  • amateur uncensoredfc2
    • 2021-01-27
    26 min

    FC2PPV 1662044 Limited to 3 days [Individual shooting] A housewife with a gambling addiction is pressed down by two men and vaginal cum shot is made with another stick.

  • amateur uncensoredfc2
    • 2021-01-24
    120 min

    [OPPW-083]I'm Gay And A Switch And I Want To Have Fun Fucks, So I Starred In Porn! Yuki Minamisawa

  • yuuki minamizawa censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-083OPPW083oppw00083
    • 2021-01-24
    132 min

    [OPPW-082]You're My Dress-Up Doll Sakuya Yuki

  • sakiya yuki censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-082OPPW082oppw00082



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies