• Log in

  • Sign up
Jav Cake
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • models
  • Tags
  • Random Videos
  • Upload your videos
    • Log in
    • Sign up
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • Random
  • amateur

  • anal

  • bdsm

  • big tits

  • blowjob

  • bukkake

  • cosplay

  • creampie

  • cumshot

  • deepthroat

  • handjob

  • hardcore

  • japan

  • lesbian

  • lingerie

  • maid

  • married woman

  • massage

  • milf

  • nurse

  • office

  • outdoor

  • school

  • schoolgirl

  • single work

  • squirt

  • teacher

  • teen

  • uniform

uinav




FC2AUKGPREDNACRNACXONEZHODVHUNTBBBANBLKAUKGDASDMEYDSSISWAAAMARAAWDDTTNATRFSDSSKBI

2024-04-18
85 min

UINAV-006 [Mecha Kawa] The No.1 Huge Breasts Concafé In Kabukicho Is After Opt.Tipached And Sick As It Is

  • censoredcreampieamateurUINAVhmn workshamedori.network secondeditionUINAV-006UINAV006h-1472uinav00006
  • 2024-04-04
    89 min

    UINAV-004 [1m Over Big Butt] Prip Rideka Ass Sister Is Separated From The Japanese.Drunk And Slut ○

  • censoredcreampieslutUINAVhmn workshamedori.network secondeditionUINAV-004UINAV004h-1472uinav00004
  • 2024-02-29
    93 min

    328UINAV-003 [Sake Ran Bitch] S -class Chat Kubile JD JD Infinite Splash Fuck That The Real Intention And Tide Do Not Stop As You Drink [Bristle Yabe]

  • amateur censoredcreampiesquirtinguinavuinav-003uinav003328uinav-003
  • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
  • 1



  • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies
    • Legal

    • 18 U.S.C. 2257
    • Contact Us
    • DMCA
    • Useful

    • Sign up
    • Log in
    • FAQ
    • Contact
    • Friends

    • Girls Do Porn
    • GirlsDoPorn
    • DaftSex
    • TayLee Wood
    • WoodmanCastingX
    •