sis




FC2MVSDMEYDSSISMILKONEZABWHODVSPRDAVSAHDKANACRWAAAPREDNATRCAWDDASDAMBIKBISDABRBD

2019-09-16
115 min

[EKDV-596]Whenever She Sees My Face, My Elder Sister-In-Law Shows Off Her G-Cup Big Tits And Lures Me To Temptation Tsugumi Morimoto

  • tsugumi morimoto censoredcreampiebig titsEKDVcrystal eizokumataro morinoe kissEKDV-596EKDV59649ekdv00596
    • 2019-08-23
    102 min

    [YSN-486]Beautiful Muscular Big Sis' Slutty Workout - Yuka Sawahara

  • yuka sawahara censoredcreampieblowjobYSNnonYSN-486YSN486h-127ysn00486
    • 2019-08-23
    59 min

    [WFR-006]Big Sis Felt Horny After Work, Got Wet The Whole Way And Went Crazy - Mao Hamasaki

  • hamazaki mao censoredsquirtingblowjobWFRwaap entertainmenttonkatsuwWFR-006WFR0062wfr00006
    • 2019-07-20
    122 min

    [HND-697]Filthy Big Sis With Super Hot Nipples Squeezes Her Vagina to Invite A Creampie Shiori Kamisaki

  • shiori kamisaki censoredcreampiebig titsHNDhon nakamiyoshi rusherHND-697HND697hnd00697
    • 2019-07-01
    480 min

    [SIS-100]8 Hours Of Incestuous Creampie Sex Videos ~Dirty Sex With My Hot Stepsisters At Home~

  • censoredcreampieslutSISglay zsisterSIS-100SIS10012sis00100
    • 2019-05-19
    154 min

    [HND-674]Secret Babymaking Life With Little Step Sister Who Loves Me Too Much Satori Fujinami

  • satori fujinami censoredcreampiebeautiful girlHNDhon nakausa pyonHND-674HND674hnd00674
    • 2019-05-01
    119 min

    [SIS-097]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 16

  • kuraki bookmark hoshisaki mica censoredcreampiesisterSISglay zsisterSIS-097SIS09712sis00097
    • 2019-04-01
    121 min

    [SIS-096]This Big Sister Wants Her Little Brother To Rape Her Maika Hoshisaki

  • hoshisaki mica censoredcreampiebig titsSISglay zsisterSIS-096SIS09612sis00096
    • 2019-03-01
    224 min

    [DOCP-130]Big Brother Watches Porn With The Sound On Even Though His Little Sister Is Asleep Next To Him. When His Little Sister Realizes What Is Happening She Tries To Pretend Like She Didn't Notice But Her Nether Region Has A Mind Of Its Own

  • suzu yamai tomomi hoshisaki censoredcreampiesisterDOCPprestigedoc premiumDOCP-130DOCP130118docp00130
    • 2019-03-01
    241 min

    [SIS-095]Drunk Girl Big Sister Obscene Sleeping Rape 4 Hours

  • censoredcreampiebig titsSISglay zsisterSIS-095SIS09512sis00095
    • 2019-02-01
    200 min

    [DOCP-125]I Mistook My Girlfriend's Little Sister For My Girlfriend And Insta-Fucked Her!？ I Only Realized After I Came. I Apologized Profusely But My Girlfriend's Sister Was Already Turned On And She Carried On Fucking Me, Orgasming Over And

  • bubble yuuki hinami yumezaki censoredcreampiebig titsDOCPprestigedoc premiumDOCP-125DOCP125118docp00125
    • 2019-01-17
    183 min

    [HUNTA-541]My Big Sis Liked It So Much When I Ate Her Out For The First Time, She Came While Squeezing Me Like A Kamakiri ! My Shy, Late-Blooming Older Sister Starting Acting Weird Once She Finally Got A Boyfriend. That's When She Suddenly Asked

  • censoredsisterHUNTAhuntercognac kaminohhh groupHUNTA-541HUNTA541hunta00541
    • 2019-01-01
    241 min

    [BUR-521]A Video Posting By A Big Brother Who Is Raping His Little Sister 4 Hours

  • censoredcreampieschoolgirlBURgraysburstBUR-521BUR52112bur00521
    • 2019-01-01
    122 min

    [SIS-094]"Help! I Came Too Much And Now My Vibrator Won't Come Out!" A Desperate Older Sisters Turns To Her Brother For Help

  • kamikawa starry sky aki sasaki censoredcreampieslutSISglay zsisterSIS-094SIS09412sis00094
    • 2018-12-01
    241 min

    [SIS-093]A Little Brother Who Has Forbidden Sex With His Hot And Horny Big Sisters In This Incest Video 4 Hours

  • censoredcreampiebig titsSISglay zsisterSIS-093SIS09312sis00093
    • 2018-11-01
    119 min

    [SIS-092]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 15

  • sena kirari aoi mizutani censoredcreampiesisterSISglay zsisterSIS-092SIS09212sis00092
    • 2018-10-27
    171 min

    [MIDE-592]The Total Domain Temptation Of A Super Horny Elder Sister In Knee-High Socks Tsubomi

  • bud censoredcosplayslutMIDEmoodyzhirokoji osakimoodyz divaMIDE-592MIDE592mide00592
    • 2018-10-05
    209 min

    [DOCP-093]"You Were Thinking Of Me, Weren't You...？" My Sister Came To Stay With Me. Her Tits Had Grown In The Few Years I Hadn't Seen Her, I Couldn't Control Myself. I Was Secretly Masturbating While She Was Sleeping, When She Gr

  • natsuko mishima sakura chinami censoredbig titssisterDOCPprestigedoc premiumDOCP-093DOCP093118docp00093
    • 2018-09-24
    117 min

    [SIS-091]Sister Night Visit Creampie Peeping Rape SIS- 091

  • haruka mirai rena abe censoredcreampiesisterSISgrayssisterSIS-091SIS09112sis00091
    • 2018-07-22
    120 min

    [XVSR-400]Naughty Creampie Life With Horny Big Sis Who's Crazy About Her Brother Yui Hatano

  • yui hatano censoredcreampieXVSRmax asono kancalenXVSR-400XVSR400xvsr00400
    • 2018-06-24
    119 min

    [SIS-088]Incestuous Cheating - Brother Fucks Sister Next to Her Boyfriend

  • shiiba mikuru oba yui censoredcreampiebig titsSISgrayssisterSIS-088SIS08812sis00088
    • 2018-06-12
    117 min

    [KTRA-036]My Little Sis -- a Tiny Body with Giant Tits

  • ann wakamoto censoredbig titsbeautiful girlKTRAk tribeKTRA-036KTRA036h-094ktra00036
    • 2018-06-10
    128 min

    [KRAY-023]Drowning In Titties A Big Tits Elder Sister With Over H Cup Titties In Excessively Loving Sex

  • nene sakura waka ninomiya censoredbig titslingerieKRAYs cuteKRAY-023KRAY023kray00023
    • 2018-06-08
    116 min

    [ARM-680]After Getting A Sexy Thigh Job By An Elder Sister That Brought My Cock To Its Rock Hard Limit, May I Stick It In Now？

  • mizuno chaoyang mizuki nagamine censoredmarried womanARMaroma planningaromaARM-680ARM680arm00680
    • 2018-04-24
    116 min

    [SIS-084]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 13

  • rena abe censoredcreampiesisterSISglayzupdatingSIS-084SIS08412sis00084
    • 2018-03-25
    103 min

    [SIS-082]A Big Sister With A Brother Complex Is Getting Horny For Her Little Brother's Cock

  • aki sasaki censoredcreampieslutSISglayzupdatingSIS-082SIS08212sis00082
    • 2018-02-16
    240 min

    [HUNTA-410]"Let Your Big Sis Cure You Of Your Premature Ejaculation!" I Suddenly Got A Cute New Big Sister-In-Law With A Hot Body I Wasn't Used To Living With A Girl, But She Dressed So Scandalously That I Couldn't Turn Away! I've

  • censoredlingerieHUNTAhunterkawajirihhh groupHUNTA-410HUNTA410hunta00410
    • 2018-01-25
    122 min

    [SIS-079]The Opening Of A Sex Club!？ My Big Sister Is Opening A Sex Club At Our House! And Her Best Customer Is Her Little Brother, Me, Every Day! Aki Sasaki

  • aki sasaki censoredcreampieslutSISgrayssisterSIS-079SIS07912sis00079
    • 2018-01-25
    126 min

    [SIS-078]Incestuous Creampie Sex with Yuzu, my Charming, Oversexed Classmate/Stepsister with a Shaved Pussy, and Arisa, My Big Sister with Huge Tits and a Brother Complex

  • yuzu kitagawa arisa hanyu censoredcreampiebig titsSISglayzupdatingSIS-078SIS07812sis00078
    • 2018-01-25
    126 min

    [SIS-077]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 12

  • sena ai narumi sayaka censoredcreampiebig titsSISgrayssisterSIS-077SIS07712sis00077
    • 2018-01-11
    181 min

    [SW-530]A Big Sis Shotacon My Big Titty Big Sisters Are Teaching My Naughty Cock A Sex Lesson! "You've Got A Big Cock For A Little Kid!" My Horny Big Sisters Were Happy To Make Me Squirt My Hot White Semen Into Them, Over And Over Again

  • censoredbig titssisterSWswitchyocchanSW-530SW5301sw00530
    • 2017-09-24
    116 min

    [SIS-069]My Big Sister Came Home A Drunk Girl So I Attacked Her And Made Her My Cum Bucket A Little Brother's Rape Video Posting Collection

  • censoredcreampiesisterSISglay 039 zupdatingSIS-069SIS06912sis00069
    • 2017-09-24
    98 min

    [SIS-070]This Little Brother Was Teased For Being A Cherry Boy, So He Filmed These Immoral Peeping Videos Of His Beautiful Big Sister

  • censoredcreampiesisterSISgrayssisterSIS-070SIS07012sis00070
    • 2017-08-22
    119 min

    [KTDS-994]A Miraculous Minimal Shaved Pussy Little Sister And A Deep And Richly Immoral Creampie Sex Fantasy Kurumi Kawashima

  • kawashima walnut censoredbeautiful girlsisterKTDSk tribeKTDS-994KTDS994h-094ktds00994
    • 2017-07-25
    103 min

    [SIS-067]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 8

  • shiori uehara censoredcreampiesisterSISgrayssisterSIS-067SIS06712sis00067
    • 2017-06-24
    101 min

    [SIS-065]Drunk Girl Girl Disordered Body Attacked By Brother in Bed In Secretly Posted Videos

  • censoredcreampiesisterSISgrayssisterSIS-065SIS06512sis00065
    • 2017-06-24
    240 min

    [SIS-066]4 Hours of Creampies - Sister Incest DX

  • censoredcreampiebig titsSISgrayssisterSIS-066SIS06612sis00066
    • 2017-06-15
    135 min

    [DSAMBD-19]KOUKOTSU : Satomi Suzuki (Blu-Ray)

  • satomi suzuki uncensored
    • 2017-05-30
    120 min

    [PT-174]Stop Enzai : Airi Mashiro

  • airi mashiro uncensoreddrama
    • 2017-05-25
    490 min

    [SIS-064]When I Ordered A Delivery Health Girl My Big Sister Came! So, We Decided To Secretly Have Creampie Sex Highlights 8 Hours

  • kanna misaki hikaru konno censoredcreampiesisterSISgrayssisterSIS-064SIS06412sis00064
    • 2017-04-24
    104 min

    [SIS-063]"Can You Withstand My Pussy？" When My Big Tits Sister Lured Me To Temptation, I Started Pumping Her To The Edge Of Ejaculation! This Hot Big Sister Is Having Multiple Writhing Orgasms With Her Little Brother's Cock And About To S

  • hasumi claire yuri nikaido censoredcreampiebig titsSISglay zsisterSIS-063SIS06312sis00063
    • 2017-02-22
    123 min

    [SIS-059]Will My Big Sister And Her Friend In The Room Next Door Have Sex With My Friend And Me？ vol. 03

  • mizuki love satomi ayase censoredbig titssquirtingSISglay 039 zupdatingSIS-059SIS05912sis00059
    • 2017-02-22
    121 min

    [SIS-058]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 6

  • kawaon walnut nana mizusaki censoredcreampiebig titsSISglay 039 zupdatingSIS-058SIS05812sis00058
    • 2017-02-03
    120 min

    [SMBD-170]S Model 170 OMOTENASHI : Rina Nanase (Blu-ray)

  • rina nanase uncensored
    • 2017-02-03
    120 min

    [SMD-170]S Model 170 OMOTENASHI : Rina Nanase

  • rina nanase uncensored
    • 2017-01-25
    121 min

    [KAGH-080]An NTR Good Time With My Mom, My Big Sister, And My Girlfriend My Friend Fucked Everyone In My Loving Family And Gave Them Creampie Sex Too

  • freedom yuki katsura censoredcreampiesisterKAGHafro filmwife s trapprincess kaguya afro filmKAGH-080KAGH080422kagh00080
    • 2017-01-25
    95 min

    [SIS-056]"You Can Never Make Me Cum With Your Lousy Technique!" That's What This Slutty Bitch Said To Me, But When I Pumped Her Full Of Aphrodisiacs, She Was Going Into Back Breaking Orgasmic Spasms! Look At Her Cum Over And Over Again! T

  • fujimoto murasakihime meiko nakao noa censoredcreampiesquirtingSISglay 039 zupdatingSIS-056SIS05612sis00056
    • 2017-01-07
    120 min

    [CWPBD-152]CATWALK POISON 152 Unbeatable Japorn No Mosaic Girl : Emiri Okazaki (Blu-ray)

  • emiri okazaki uncensored



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies