school uniform censored molester high vision schoolgirl




FC2HZGDGVHSQTEMIDEHDKASDABKBINACXPREDSPRDMIDVHMNMVSDWAAASSNIMILKAMBIBBANNNPJAWD

2020-10-10
219 min

[HJMO-443]Couples' Challenge! If The Husband Can't Withstand Tsubomi's Incredible Sex Techniques Two Times, The Wife Will Take Another Guy's Creampie!

  • bud censoredcreampieslutHJMOhajime kikakuhajimeHJMO-443HJMO443hjmo00443
    • 2020-10-12
    54 min

    TKWA-119 Yuri

  • amateur censoredcreampiebig titstkwatkwa-119tkwa119tkwa-119
    • 2020-10-13
    62 min

    HEYZO 2373 Remi Wants To Get Multiple Orgasm!! – Remi Hashimoto

  • remi hashimoto uncensoredcreampieheyzo
    • 2020-10-18
    149 min

    [MMSK-001]24-Hour Cum Control Ichika Matsumoto

  • ichika matsumoto censoredcreampieslutMMSKmarrionm buildingMMSK-001MMSK001mmsk00001
    • 2020-10-22
    224 min

    [PIYO-086]Hyoko Anniversary. An Older Man Impregnating Barely Legal Girls By Rubbing Sperm All Over Them During A Massage (Without Them Noticing)

  • censoredcreampiesquirtingPIYOhyokopiero dagrey wolfPIYO-086PIYO0861piyo00086
    • 2020-10-23
    34 min

    FC2PPV 1544077 [Personal shooting] Infiltrate a secret orgy ⑲ A big-breasted single mother presents herself to the Osans for living expenses … Something like an AV project has happened in reality! * High-quality version & review benefits inc

  • amateur uncensoredfc2
    • 2020-11-06
    46 min

    [BTH-086]A Slut For Rent W

  • miki mizusawa rina fukada rina fukada censoredblowjobslutBTHchobitchsuper bitchBTH-086BTH086h-1435bth00086
    • 2020-11-30
    77 min

    IDJS-022 Natsuki

  • amateur censoredcreampiebig titsidjsidjs-022idjs022idjs-022
    • 2020-12-02
    77 min

    259LUXU-1350 Luxury TV 1334 Now is the season! A culinary researcher who is attracting attention with a glamorous body that is ready to eat appears on Luxury TV! “I want to taste intense sex …” Fucking wrapped in a plump H cup! A dexte

  • amateur censoredbig titsamateurluxuluxu-1350luxu1350259luxu-1350
    • 2020-12-05
    63 min

    407KAG-117 It’s a perverted delusion that is humiliated! !! Saddle up an intelligent office lady with a service temperament ww

  • amateur censoredbig titsamateurkagkag-117kag117407kag-117
    • 2020-12-13
    151 min

    [CHRV-122]My Little Stepsister Is A Shoplifter Who Hides Her Stolen Wares In Her Cleavage, But She Didn't Realize That Hot Shoplifters Get Fucked! B Is For Busted! L Is For Loose Socks! T Is For Thong! My Little Stepsister Has Big Tits Worth More

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-122CHRV122chrv00122
    • 2020-12-17
    134 min

    [JRZE-015]First Time Filming My Affair - Yuri Mizukawa

  • yuri mizukawa censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-015JRZE015h-086jrze00015
    • 2020-12-21
    45 min

    [ZOZO-027]Wan Horikita

  • horikita wa censoredZOZOsadistic villageZOZO-027ZOZO0271zozo00027
    • 2020-12-25
    72 min

    [DHT-188]A More-Than-20-Years-Age Gap May-December Romance Set Up On A Hookup App Seducing Girls Who Love Withered Old Men Kanon 21 Years Old

  • censoredamateurbeautiful girlDHThot entertainmententhusiastDHT-188DHT18859dht00188
    • 2020-12-25
    51 min

    [MASE-010][Available Online For A Limited Time] 40-Something Mademoiselle Fucked And Creampied Trophy Wife Loses Her Mind Haru

  • censoredcreampiemarried womanMASEcrystal picturemadam maniac plusMASE-010MASE01049mase00010
    • 2020-12-31
    70 min

    200GANA-2414 Seriously Nampa, first shot. 1576 Successful pick-up of a kind-hearted nursery teacher! I got the goddess who forgives me even if I rubbed the fluffy G cup boobs as it is ♪

  • amateur censoredbig titsamateurganagana-2414gana2414200gana-2414
    • 2021-01-01
    120 min

    [NACR-385]Tempted By A Sexually Frustrated Son's Wife Satomi Suzuki

  • satomi suzuki censoredcreampieblowjobNACRplanet pluscherryshichidomeNACR-385NACR385h-237nacr00385
    • 2021-01-07
    244 min

    [FZR-066]Hot Slender Married Woman's Impregnation Awakening - Bred With A Creampie Through Cheating Sex 240 Minutes

  • censoredcreampiemarried womanFZRhamedori.network secondeditionFZR-066FZR0663fzr00066
    • 2021-01-07
    59 min

    [loli-032]いずみ

  • amateur censoredcreampieschoolgirlloliloli-032loli032loli-032
    • 2021-01-10
    121 min

    FC2PPV 1638113 Half price with a limited number! [The sequel to the miracle! If you make your debut in the art world, it’s a dangerous video] It’s a super beautiful girl that can only be seen here. Conceived in godly plain clothes & ero

  • amateur uncensoredfc2
    • 2021-01-10
    135 min

    [AVSA-151]SUPER FISHEYE FETISHISM Extreme Erotic Closeups - Office Girl's Voluptuous Curves Kaho Imai

  • natsuho imai censoredsingle workAVSAavs collector sbuddha davscollector sAVSA-151AVSA151avsa00151
    • 2021-01-12
    63 min

    10musume 011221_01 What if I show my unerected penis to a cute girl？ Natsumi Owada

  • amateur uncensored10musume
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    61 min

    Pacopacomama 011621_422 Yui Minami

  • yui minami uncensoredcreampieblowjobpacopacomama
    • 2021-01-20
    42 min

    FC2PPV 1652394 [No] [Limited to 100 pieces 1000pt OFF!] 2 consecutive vaginal cum shots for active idols ♥ ️ Shortcut slender loli beautiful girl ♥ ️ Complete appearance raw vaginal cum shot sex lifted! ♥ ️ * Review benefits / Gokkun Blow while elect

  • amateur uncensoredfc2
    • 2021-02-05
    244 min

    [HEZ-249]Beautiful Witch Picking Up Girls!! Shimiken Moans! Mature Woman Beyond Reason Raw FUCK! 4 Hours DX 3

  • shiken ken shimizu censoredcreampiebig titsHEZhot entertainmentone yenHEZ-249HEZ24959hez00249
    • 2021-02-05
    241 min

    [HEZ-245]The Real Voices Of Married Woman Babes I Never Ever Thought About Committing Infidelity. But, When He Called Out To Me On The Street, I Found Myself Going Along With Him. 12 Ladies 4 Hours

  • censoredamateurHEZhot entertainmentHEZ-245HEZ24559hez00245
    • 2021-02-21
    233 min

    [REXD-352]Good Luck Has Come! Piledriving Her Into The Ground! "I Guess You Can Smell It, If It's Just A Little..."

  • censoredcreampieamateurREXDredmanji groupREXD-352REXD352rexd00352
    • 2021-02-23
    144 min

    [KUSE-007]Slender Mysterious Girl With A C***dlike Face And Small Breasts Super Masochistic Government Worker Inori Sasage Porno Debut

  • dedication glue censoredamateurdeepthroatKUSEsodevening publicationtheKUSE-007KUSE0071kuse00007
    • 2021-02-27
    240 min

    [FSPT-009]10 Loads In A Row Creampie: Youthful And Fiery, 10 People, 240 Min.

  • censoredbig titsschoolgirlFSPTfirst starpeachteenFSPT-009FSPT009h-491fspt00009
    • 2021-03-04
    244 min

    [CVDX-438]She'll Suck Up Every Last Drop Of Semen!! Immediately After Orgasmic Creampie Sex, This Horny Old Lady Will Follow Up With A Cleanup Blowjob On His Sensitive Cock 30 Ladies 4 Hours

  • censoredcreampieblowjobCVDXcenter villageCVDX-438CVDX438h-086cvdx00438
    • 2021-03-12
    88 min

    TNS-001 Sara

  • amateur censoredamateurtnstns-001tns001tns-001
    • 2021-03-12
    42 min

    FC2PPV 1723507 <Squirting instructor> [Obvious glossy body strike] Fithch sensual body that loves semen has begged for vaginal cum shot on LINE, so I injected plenty into the back of the vagina.

  • amateur uncensoredfc2
    • 2021-03-19
    243 min

    [KSBJ-125]Naked Wife Highlights vol. 6

  • ashamed anju minase censoredbig titsmarried womanKSBJksb planning emanuelKSBJ-125KSBJ125ksbj00125
    • 2021-04-01
    167 min

    [DROP-059]These Amateur Girls Were Shown Fully Erect Cocks, And That Got Them Excited For Some Hot Sex vol. 3

  • censoredcreampieamateurDROPoffice k sdrop office k sDROP-059DROP05936drop00059
    • 2021-04-16
    131 min

    [HZGD-185]My Neighbor Is A Massage Parlor Therapist And She Sensually Aroused Me And Fucked My Brains Out, Because She's A J-Cup Titty Beautiful Squirting Housewife Babe With Colossal Tits Chitose Yuki

  • chitose in the evening censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-185HZGD185h-1100hzgd00185
    • 2021-04-24
    151 min

    [MMKZ-095]Her Filthy Booty's So Fine It Made Me Lose My Mind! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-095MMKZ095mmkz00095
    • 2021-04-27
    39 min

    490FAN-046 Kasumi

  • amateur censoredamateurfanfan-046fan046490fan-046
    • 2021-04-30
    30 min

    HEYZO 2525 Creampie in America #Sophia3 – Sophia

  • sophia uncensoredheyzo
    • 2021-05-11
    480 min

    [MUCH-128]Hips Over 40"! Girls With Big Bangin' Booty - Dynamite SEX 10-Girl Compilation, 8 Hours, 2 Discs

  • shizuka ishikawa urara motomura censoredcreampieMUCHmothermuchi mutchiMUCH-128MUCH128h-796much00128
    • 2021-05-29
    59 min

    1Pondo 052921_001 Full body massage by a sailor cutie: Erika Shiomi

  • amateur uncensored1pondo
    • 2021-06-01
    40 min

    475SKCK-033 Himena 1

  • amateur censoredanalamateurskckskck-033skck033475skck-033
    • 2021-06-19
    117 min

    [HMN-009]For The Sake Of Her Impotent This Married Woman She Went To This Rundown Dump And Enjoyed Deep And Rich Impregnation Sex With A Single Man Who Had Spent The Past 30 Days Storing His Semen Hikari Kisaki

  • ayu sakurai censoredsingle workHMNsaimin kenkyuujosaimin mansionHMN-009HMN009h-443hmn00009
    • 2021-06-20
    63 min

    FC2PPV 1878480 [Reading notice] Infiltrate the SEX housing complex where married women and SEX addicts ♀ are invading! An H-cup woman who is crazy about sexual desire at an orgy party that is opened every day! All you can commit! All-you-can-eat vagi

  • amateur uncensoredfc2
    • 2021-06-26
    82 min

    200GANA-2514 Seriously Nampa, first shot. 1653 A beautiful salon model who continues to pass by her boyfriend! If you stimulate the sexual desire that can not be released by masturbation … The erotic cute nature that screams with a sweet voice!

  • amateur censoredamateurganagana-2514gana2514200gana-2514
    • 2021-07-14
    251 min

    [SSIS-161]A Previously Unreleased Premium Edition! Pleasure! First Experiences 8 We'll Show You Plenty Of Saika Having Plenty Of Sex 3 Fucks A 240-Minute Special Saika Kawakita

  • ayaka hebei censoredbeautiful girlsingle workSSISs1 no 1 stylekyoseiSSIS-161SSIS161ssis00161
    • 2021-08-21
    239 min

    [NANX-235]A Pair Of Older Women On A Night Out Over The Weekend At A Bar. Lonely Living Without Boyfriends, They Pick Up Guys In The Bar And No Matter What You Say You Cannot Escape Their Grasp 2!!

  • censoredbig titsmature womanNANXk m producenanpa heavenNANX-235NANX235nanx00235
    • 2021-08-21
    64 min

    383REIW-088 Noa

  • amateur censoredcreampiebig titsreiwreiw-088reiw088383reiw-088



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies