s1




FC2GVHMARAJUFEADNMILKCAWDMEYDPREDDASDCESDEBODHODVONEZMIDVAUKSMIDEWANZSDABMVSDSQTE

2019-11-30
157 min

[SSNI-637]Her Pussy Twitches When She Climaxes, Getting The Fucking Of Her Life, Hard And Relentless - Nodoka Sakuraba

  • sakuraha nodoka censoredbig titssquirtingSSNIs1 no 1 styledragon nishikawaSSNI-637SSNI637ssni00637
    • 2019-11-30
    120 min

    [SSNI-630]This Is A 1-Year Video Record Of How I Was Made To Participate In A Contest To Make Women Cum While Riding The Train Moe Amatsuka

  • angel moe censoredbeautiful girlSSNIs one number one stylesugawaras1 no 1 styleSSNI-630SSNI630ssni00630
    • 2019-11-30
    120 min

    [SSNI-633]When My Girlfriend Went Away On Business For 3 Days, I Fucked Her Younger Sister Every Day From Morning Until Night - Miru Sakamichi

  • see the slope censoredbeautiful girlsisterSSNIs one number one stylekitorune kawaguchis1 no 1 styleSSNI-633SSNI633ssni00633
    • 2019-11-30
    150 min

    [SSNI-631]A Female Boss With Big Tits And Her Employee Of The Month Go On A Business Trip Together And Spend The Entire Time Having Adulterous Sex - Saki Okuda

  • saki okuda censoredbig titsmarried womanSSNIs one number one stylebungo maedas1 no 1 styleSSNI-631SSNI631ssni00631
    • 2019-11-30
    120 min

    [SSNI-641]Extremely Small Micro Bikini - She Covers Herself In Lotion And Plays With You Nice And Close - Ema Shiiba

  • emma shiiba censoredslutSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-641SSNI641ssni00641
    • 2019-11-30
    131 min

    [SSNI-640]Mixed Body Fluids, Deep Sex Complete And Uncut Special Rin Kira

  • kira rin censoredsquirtingbeautiful girlSSNIs1 no 1 stylelamb chopSSNI-640SSNI640ssni00640
    • 2019-11-30
    120 min

    [SSNI-632]Her Pussy Twitches With Excitement When She Gets Fucked Hard And Fast! - Miharu Usa

  • miharu hanasaki censoredbig titsSSNIs one number one stylegoemons1 no 1 styleSSNI-632SSNI632ssni00632
    • 2019-11-30
    156 min

    [SSNI-638]Sweaty Sex With H-Cup Tits In Tight-Fitting Sportswear - Mao Mashiro

  • pure white censoredbig titssingle workSSNIs1 no 1 styledragon nishikawaSSNI-638SSNI638ssni00638
    • 2019-11-30
    120 min

    [SSNI-643]A Woman With Divine Titties Lala Anzai Her Adult Video Debut Miraculous Huge Tits A 7-Tit-Jamming Special

  • anzai rara censoredbig titsSSNIs one number one stylecrests1 no 1 styleSSNI-643SSNI643ssni00643
    • 2019-11-30
    120 min

    [SSNI-636]My Stepsister Has Blossomed And Grown Some Huge Tits, So When I Went Home For The Weekend, I Secretly Fucked Her The Entire Time - Rika Aimi

  • rumi tadami censoredbig titsschoolgirlSSNIs one number one stylekitorune kawaguchis1 no 1 styleSSNI-636SSNI636ssni00636
    • 2019-11-14
    118 min

    [SSNI-619]I Was Having Life-Destroying Orgasmic Sex With The Married Woman Next Door Tsukasa Aoi

  • tsukasa aoi censoredsingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-619SSNI619ssni00619
    • 2019-11-14
    136 min

    [SSNI-628]She Cums 96 Times! She Spasms 3,000 Times! She Squirts 2,100cc Of Pussy Juice! - A Slim Girl With Massive Tits Experiences Overwhelming Spasming Sex - Amin Niina

  • new name amin censoredbig titssquirtingSSNIs1 no 1 stylemon cSSNI-628SSNI628ssni00628
    • 2019-11-14
    120 min

    [SSNI-627]27 Years Old - Falling Into Disgrace Before She Reaches 30 - She Climaxes So Hard You Can See Her Ribs! She Orgasms With A Huge Dick Rubbing Against Her G-Spot! - Shihori Kotoi

  • shiori kotoi censoreddeepthroatsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-627SSNI627ssni00627
    • 2019-11-14
    118 min

    [SSNI-622]This Man Is Tied Up And Unable To Move As This Healthy Slut With A Beautiful Body Keeps On Assaulting Him With A Smile As She Fully Controls His Ejaculations Nene Yoshitaka

  • nine yoshitaka censoredslutsingle workSSNIs one number one stylecrests1 no 1 styleSSNI-622SSNI622ssni00622
    • 2019-11-14
    120 min

    [SSNI-623]While My Girlfriend Was Away, I Spent 3 Days Fucking The Shit Out Of My Girlfriend's Best Friend, An Adult Video Actress Yura Kano

  • yura kanno censoredbeautiful girlsingle workSSNIs one number one styleasagiris1 no 1 styleSSNI-623SSNI623ssni00623
    • 2019-11-14
    119 min

    [SSNI-620]A Tiny Girlfriend With Light Skin And Big Tits Is Getting Stroked By Her Big Dick Friend In A Horse-Hung Straddling Fuck Fest For Cuckold Pleasure Palace Orgasmic Ecstasy Aika Yumeno

  • yumeno aika censoredbig titssingle workSSNIs one number one styleasagiris1 no 1 styleSSNI-620SSNI620ssni00620
    • 2019-11-14
    152 min

    [SSNI-625]Welcome To The Super High Class J-Cup Sex Club Condo Enjoy A 150-Minute Full Course Of Jun Kakei's Hard And Tight Sensual Techniques

  • jun jun censoredbig titssingle workSSNIs one number one stylezampas1 no 1 styleSSNI-625SSNI625ssni00625
    • 2019-11-14
    120 min

    [SSNI-621]Her Legs Measure 88cm From Her Crotch To The Floor A Barely Legal Babe With Beautiful Legs The Temptation Of A High-Cut Uniform Arina Hashimoto

  • there is hashimoto censoredsquirtinguniformSSNIs one number one stylekyouseis1 no 1 styleSSNI-621SSNI621ssni00621
    • 2019-11-14
    195 min

    [SSNI-626]Mixed Body Fluids, Deep Sex Complete And Uncut Special Marin Hinata

  • marin hinata censoredbig titssingle workSSNIs1 no 1 stylemon cSSNI-626SSNI626ssni00626
    • 2019-11-14
    122 min

    [SSNI-629]A Sensual Slim Body Hiyori Yoshioka Hear Her Scream! Watch Her Cum! See Her Seriously Cum! A 3 First Experiences Special

  • hiyori yoshioka censoredsquirtingblowjobSSNIs1 no 1 stylezaku araiSSNI-629SSNI629ssni00629
    • 2019-11-14
    210 min

    [SSNI-618]Total Domain A Voluptuous Thighs In Uniform Peek-A-Boo Show A Bare-Legged Idol In The Ultimate Temptation A Little Devil Beautiful Girl In Knee-High Socks Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-618SSNI618ssni00618
    • 2019-11-14
    119 min

    [SSNI-624]3 Years Ago My Lady Boss Retired To Get Married, But Now That She's Back, I Spent 3 Days At A Hotel During My Business Trip Fucking Her Brains Out, And Here's The Video Record To Prove It Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSNIs one number one stylemeat respects1 no 1 styleSSNI-624SSNI624ssni00624
    • 2019-11-02
    150 min

    [SSNI-613]Mixed Body Fluids, Deep Sex A Totally Uncut Special Mao Mashiro

  • pure white censoredbig titssingle workSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-613SSNI613ssni00613
    • 2019-11-02
    479 min

    [OFJE-220]Ichika Hoshimiya Her First Best Hits Collection It's The First Anniversary Of Her S1 Debut Her Newest 11 Titles 8-Hour Special

  • ichika hoshimiya censoredblowjobslutOFJEs1 no 1 styleOFJE-220OFJE220ofje00220
    • 2019-11-02
    119 min

    [SSNI-609]Attacked By School Swimsuit Fetishists - A Schoolgirl In Uniform Gets Stalked And Gang-Banged, And Her Attackers Get It All On Video - Shion Yumi

  • evening beauty censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-609SSNI609ssni00609
    • 2019-11-02
    120 min

    [SSNI-608]She Experiences Ultimate Pleasure, Getting Fucked Aggressively Until She Squirts Huge Loads Of Pussy Juice - Miru Sakamichi

  • see the slope censoredsquirtingbeautiful girlSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-608SSNI608ssni00608
    • 2019-11-02
    120 min

    [SSNI-611]Sensual Stimulation With Cum Facial Aphrodisiac Lotion! She's Awakening Her Ultra Sensual Full Body Erogenous Zone! A New Encounter With Slick And Slippery Orgasmic Sex Rika Aimi

  • rumi tadami censoredbig titssingle workSSNIs one number one stylesugawaras1 no 1 styleSSNI-611SSNI611ssni00611
    • 2019-11-02
    120 min

    [SSNI-615]An 18-Year Old Diamond-In-The-Rough A Beautiful Girl Rin Kira Super Orgasmic Cumming! Her First Squirting! Her First Experiences A 3-Fuck Special

  • kira ri censoredsquirtingbeautiful girlSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-615SSNI615ssni00615
    • 2019-11-02
    118 min

    [SSNI-606]There Was Nothing To Do In The Country This Summer, So I Let The Big Tits Wife From Next Door Lure Me To Temptation And Had Sweaty, Slow Sex Every Single Day Sai Okuda

  • saki okuda censoredbig titsslutSSNIs1 no 1 stylekitorune kawaguchiSSNI-606SSNI606ssni00606
    • 2019-11-02
    150 min

    [SSNI-617]New Face NO.1 STYLE Sora Amakawa's Porn Debut

  • tenkawa sora censoredsquirtingblowjobSSNIs1 no 1 stylemon cSSNI-617SSNI617ssni00617
    • 2019-11-02
    119 min

    [SSNI-610]The Investigator Got Her Pure Sailor Uniform Defiled And Soiled The Virgin Deflowering And Penetrating Fuck Fest! Hotaru Nogi

  • nogi firefly censoredblowjobbeautiful girlSSNIs1 no 1 stylebungo maedaSSNI-610SSNI610ssni00610
    • 2019-11-02
    120 min

    [SSNI-616]A 175cm Tall Woman Climbs On Top Of You And Dominates You - She Spreads Your Legs And Rides You Cowgirl Style - Ema Shiiba

  • emma shiiba censoredSSNIs one number one styletake ds1 no 1 styleSSNI-616SSNI616ssni00616
    • 2019-11-02
    159 min

    [SSNI-614]124 Furious Orgasms! 4560 Spasms! 8700 cc Of Cum Fluid! A 19-Year Old Totally Beautiful Girl An Eros Company Awakening Her First Ultra Spasmic Special Riko Shiraha

  • riko shirahaba censoredsquirtingsingle workSSNIs one number one styledragon nishikawas1 no 1 styleSSNI-614SSNI614ssni00614
    • 2019-11-02
    149 min

    [SSNI-605]While I Was Away During A Business Trip, My Girlfriend Was Lovey Dovey Fucking My Boss From Morning Til Night For 2 Straight Days Moe Amatsuka

  • angel moe censoredbeautiful girlsingle workSSNIs1 no 1 stylemon cSSNI-605SSNI605ssni00605
    • 2019-11-02
    150 min

    [SSNI-612]A Beautiful Young Girl And A Middle-Aged Man Engage In Extreme, Vulgar Tongue-Kissing And Sex - Nodoka Sakuraba

  • sakuraha nodoka censoredbig titsblowjobSSNIs one number one styleusapyons1 no 1 styleSSNI-612SSNI612ssni00612
    • 2019-11-02
    149 min

    [SSNI-607]After One Year Of Having Her Hands And Feet Tied Up Every Day In A Damp And Dark Room, She Emerges As A Masochistic Sex Girl In Uniform - Miharu Usa

  • miharu hanasaki censoredbig titsbeautiful girlSSNIs1 no 1 stylesuisei akaiSSNI-607SSNI607ssni00607
    • 2019-10-12
    180 min

    [SSNI-591]This Sexual Salon Offers Exciting Dirty Talk Therapy And Slow, Relaxing Sex - Tsukasa Aoi

  • tsukasa aoi censoredslutsingle workSSNIs1 no 1 stylehiroharu osakiSSNI-591SSNI591ssni00591
    • 2019-10-12
    118 min

    [SSNI-598]The Piston Fucking Continues In Waves Even After She's Already Cum, Making Her Goddess Tits Shake Violently - Jun Kakei

  • jun jun censoredbig titsbeautiful girlSSNIs1 no 1 stylemon cSSNI-598SSNI598ssni00598
    • 2019-10-12
    149 min

    [SSNI-589]Noa Mikami Is Cumming With All Her Might

  • yua mikami censoredbig titsslutSSNIs1 no 1 stylecrestSSNI-589SSNI589ssni00589
    • 2019-10-12
    156 min

    [SSNI-596]Golden body arching backwards like a shrimp, she's addicted to coming as she gets struck by four big things! Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSNIs1 no 1 stylesugawaraSSNI-596SSNI596ssni00596
    • 2019-10-12
    120 min

    [SSNI-600]Voluptuous Bulging Beautiful Big Asses Mahoro Kamiki

  • mahoro kamiki censoredsingle workSSNIs1 no 1 styleichigoharaSSNI-600SSNI600ssni00600
    • 2019-10-12
    118 min

    [SSNI-594]In The School Library, That Bookworm Girl Started Giggling While She's Tied Up And Can't Move... Nene Yoshitaka

  • nine yoshitaka censoredbeautiful girlslutSSNIs1 no 1 stylekyouseiSSNI-594SSNI594ssni00594
    • 2019-10-12
    119 min

    [SSNI-590]"You're Always Looking At Me, Right？" - She Smiles Sweetly, Wearing Her School Swimsuit... She Knows Everything Already... She's Ready To Turn The Tables On You! - Nami Hoshino

  • nami hoshino censoredslutsingle workSSNIs1 no 1 stylekyouseiSSNI-590SSNI590ssni00590
    • 2019-10-12
    161 min

    [SSNI-592]Reverse Violation Slut Makes A Man Continuously Ejaculate While He Can't Get Away! Aika Yumeno

  • yumeno aika censoredbig titsslutSSNIs1 no 1 styleusapyonSSNI-592SSNI592ssni00592
    • 2019-10-12
    172 min

    [SSNI-595]Taken Home By A Sweaty Middle-Aged Man, She Gets Broken In With Perverted Tongue-Kissing, Covered In Sweat And Drool - Yura Kano

  • yura kanno censoredbeautiful girlsingle workSSNIs1 no 1 stylegoemonSSNI-595SSNI595ssni00595
    • 2019-10-12
    155 min

    [SSNI-602]This Slender And Beautiful Barely Legal Is Seriously Cumming! 4 First Experiences Special Amin Nina

  • new name amin censoredbig titsbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-602SSNI602ssni00602
    • 2019-10-12
    120 min

    [SSNI-597]Climax G-Spot Development: Giant x Back Of Vagina Pressure Climax Orgasm - Mako Iga

  • iga mako censoredbeautiful girlSSNIs one number one styleusapyons1 no 1 styleSSNI-597SSNI597ssni00597
    • 2019-10-12
    150 min

    [SSNI-603]FANZA Award Winning Actress Is A Gorgeous Co-Star! Up, Down, Behind, Left, Right, Getting Slutty Simultaneously! 360 Degree Pleasure MAX Dream Reverse 3P

  • angel moe see the slope censoredbeautiful girlslutSSNIs1 no 1 stylemon cSSNI-603SSNI603ssni00603



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies