javcensored jav hours more high vision censored




FC2SDABMIDEAUKSJULDTTIPXSHKDSSNIGMEMMIAAWAAAVEMASTARSSQTENACRJUFEMARASPRDCHRVPRED

2020-10-19
47 min

305TRUMG-128 Kyoka

  • amateur censoredamateurtrumgtrumg-128trumg128305trumg-128
    • 2020-10-30
    39 min

    [CLO-091]You're The One Who Said, "I Want You To Bully My Nipples..." - Layla Hadzuki

  • hazuki leila censoredblowjobslutCLOchobitchchovicCLO-091CLO091h-1435clo00091
    • 2020-11-13
    145 min

    [BAHP-056]Two Sluts So Horny They Called A Guy To A Love Hotel To Fuck Them - Footage Of Sweaty Sizzling Threesome Sex

  • aya mamiya mizuki yayoi censoredblowjobBAHPbaltandaibutsu yoshidahoppinBAHP-056BAHP056bahp00056
    • 2020-11-23
    84 min

    300MAAN-603 [Cleavage Idol Cosplay in Halloween 2020] Taputapu Boobs + Kiwakiwa Miniskirt Cosplay Selfie Beauty Discovered! !! Invite to a luxurious Halloween-style hotel! Electric masturbation in a tipsy mood! Fully open with the addition of Ji ● Ko

  • amateur censoredcreampieamateurmaanmaan-603maan603300maan-603
    • 2020-12-17
    118 min

    [PPPD-890]When I Realized What Had Happened, I Was Being Taken Care Of By Two Of My Female Colleagues Who Were Giving Me Titty Fuck Action These Big Tits Slut Babes Were Sliding My Cock In Between Their Double Team Of Slimy Tits Honoka Tsujii Rika Ts

  • tsujii honoka tsubaki rika censoredcreampiebig titsPPPDoppaiPPPD-890PPPD890pppd00890
    • 2020-12-20
    109 min

    300MIUM-657 [Lori big breasts at the end of this year] Rent a cute baby-faced female college first grader as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoying a date, Ich

  • amateur censoredcreampieamateurmiummium-657mium657300mium-657
    • 2020-12-31
    240 min

    [DVDMS-617]Spying On Ordinary Girls - A Female Office Worker And Her Two Younger Male Coworkers Stay In The Same Hotel On A Business Trip, But Who Would've Thought They'd Be In The Same Room! One Thing Leads To Another And Soon They're Do

  • censoredcreampieamateurDVDMSdeep sDVDMS-617DVDMS617dvdms00617
    • 2021-01-01
    96 min

    [VENU-996]I Can't Live Without My Stepson... Sexy Stepmoms Indulge In the Ultimate Erotic Creampie Fucks - 50 Incredible Orgasms Yu Shinoda

  • shinoda yu censoredcreampiebig titsVENUvenuspeterfakecest winntersVENU-996VENU996venu00996
    • 2021-01-04
    102 min

    300MIUM-659 Explosive huge breasts I cup married woman! !! Big breasts mountain range that appeared in Shinagawa! You can massage it! You can smoke! You can pinch it! An erection is inevitable due to the overwhelming softness! [Frustration that incre

  • amateur censoredcreampiebig titsmiummium-659mium659300mium-659
    • 2021-01-06
    37 min

    [sika-028]アン 2(18)

  • amateur censoreduniformschoolgirlsikasika-028sika028sika-028
    • 2021-01-21
    170 min

    [DANDY-746]Ass-Shaking Cowgirl Sex While Restraining A Man With A Boner. An Esthetician With A Beautiful Ass Milks Men Dry In A Massage Parlor vol. 3

  • nana maeno kiyoshi maihara censoredslutDANDYdandybacon tanakaDANDY-746DANDY7461dandy00746
    • 2021-01-22
    74 min

    [OTIM-052](For Streaming Editions) (Daydream POV Fantasies) Ovulation Day Babymaking Sex With A Maid Who Will Do Whatever I Say And Will Belong Only To Me Kanna Shiraishi

  • shiraishi plane censoredcreampieblowjobOTIMprestigeonetimeOTIM-052OTIM052118otim00052
    • 2021-01-24
    27 min

    FC2PPV 1657528 Until 27th 2480pt → 1980pt [Personal shooting] Beautiful office lady at the reception desk of the company ・ Because the repayment period has expired, four other sticks will receive interest in the car.

  • amateur uncensoredfc2
    • 2021-01-25
    66 min

    [SHH-018]Tiny-Titted Slut Cries Out For Cock... And Teases It Until You Cum!

  • censoredbeautiful girlslutSHHnatural highSHH-018SHH0181shh00018
    • 2021-01-31
    52 min

    [orex-240]美緒

  • amateur censoredcreampiesquirtingorexorex-240orex240orex-240
    • 2021-02-06
    120 min

    [JUL-471]My Husband Can't Satisfy Me... Married Slut Needs Her Boss's Huge Cock Riho Fujimori

  • riho fujimori censoredbig titsmature womanJULmadonnakitorune kawaguchiJUL-471JUL471jul00471
    • 2021-02-09
    74 min

    FC2PPV 1678688 * Unauthorized vaginal cum shot Shaved Loli anime voice beautiful girl NTR ♥ Boyfriend’s uterus skewered piston does not reach reason collapse agony acme ♥ A large amount of cheating semen is poured on a dangerous day pussy and cu

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    73 min

    [SLRO-006]A Hostess I Met In Nagasaki Puts On A Show Barely Dressed! Himeka Saotome

  • amateur censoredbig titsbeautiful girlSLROcraneSLRO-006SLRO006
    • 2021-02-27
    46 min

    C0930 hitozuma1349 Itsumi Takekura 27years old

  • amateur uncensoredc0930
    • 2021-02-27
    240 min

    [BDSR-440]Real Practical Masturbation Support! Wet And Dirty MAX Bukkake Countdown, 4 Hours, 30 Orgasms

  • censoredbig titsbukkakeBDSRbig morkaljiro kanekoBDSR-440BDSR44057bdsr00440
    • 2021-03-11
    129 min

    [HMNF-072]Fast Rythm Sex Life 06 Shizuku Takahashi And Mayu Suzuki

  • takahashi drop suzuki mayu censoredbig titsblowjobHMNFhmjmcompany matsmanon fictionHMNF-072HMNF072h-172hmnf00072
    • 2021-03-12
    97 min

    300MAAN-633 [Super Sensitive Service Lovers x Hcup Lingerie Salesperson] Post erotic promotional videos with huge breasts H cups, lewd underwear salesperson! Intense vacuum caress sperm dobadoba mouth ejaculation! Lingerie that makes the best body st

  • amateur censoredcreampiebig titsmaanmaan-633maan633300maan-633
    • 2021-03-15
    54 min

    FC2PPV 1727715 Gonzo with a 36-year-old married woman! !! Go on a hot spring trip with a very neat wife and go crazy! !! As usual, I’m fluttering and rolling! [High image quality]

  • amateur uncensoredfc2
    • 2021-04-08
    24 min

    HEYZO 2495 Marina’s Orgasms with Toys – Marina Hasumi

  • marina hasumi uncensoredheyzo
    • 2021-04-09
    146 min

    [MIDE-913]Cumming Just From Rim Jobs! Special Licking Brothel Tsubomi

  • bud censoredblowjobslutMIDEmoodyztequilia tinomoodyz divaMIDE-913MIDE913mide00913
    • 2021-04-15
    132 min

    [NYL-004]Tied Up Big Titted Female President Rui Ayukawa 50 Years Old

  • ayukawa rui censoredbig titsmature womanNYLnile daydream tribeichikan abashiriNYL-004NYL004nyl00004
    • 2021-04-24
    51 min

    492JCHA-026 There is no reason why JK taken in erotic videos is naive!

  • amateur censoreduniformschoolgirljchajcha-026jcha026492jcha-026
    • 2021-05-06
    107 min

    [SPRD-1406]Nervous Step Mom And The Step Son That Fucked Her Raw Chisato Shoda

  • shota chisato censoredcreampiemature womanSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1406SPRD140618sprd01406
    • 2021-05-07
    180 min

    [MIDE-925]Super Exquisite Body Body Fluids / Sweat / Squirting / Liquids / Spit / Saliva Body Fluid Covered Sex Special Aoi Tsubasa

  • tsubasa aoi censoredsquirtingbeautiful girlMIDEmoodyzusa pyonmoodyz divaMIDE-925MIDE925mide00925
    • 2021-05-15
    55 min

    383REIW-065 Ren

  • amateur censoredcreampiebig titsreiwreiw-065reiw065383reiw-065
    • 2021-05-21
    52 min

    509JPAK-012 Yuzu

  • amateur censoreduniformschoolgirljpakjpak-012jpak012509jpak-012
    • 2021-05-30
    89 min

    420POW-026 Nibu-chan [Amateur Hoi Hoi power / Gonzo / Teen / Beautiful girl / School girl / Big breasts / Pink areola / Neat / Mini system / Countryside / Metamorphosis service / Shy shop / Moody lewd / Spanking]

  • amateur censoredbig titsuniformpowpow-026pow026420pow-026
    • 2021-06-04
    120 min

    [JUL-602]Madonna Popular Exclusive Shame Series First Appearance! Woman Is Made To Cum Over And Over By A Man She Despises... Kana Mito

  • kana mito censoredmature womansingle workJULmadonnajo asagiriJUL-602JUL602jul00602
    • 2021-06-17
    118 min

    [BBTU-015]Submissive Girl With Big Tits Screams And Cums Like Crazy As She Has Her Huge Titties Covered With Cum Yuria Yoshine

  • yoshine yuria censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-015BBTU015bbtu00015
    • 2021-07-03
    55 min

    HEYZO 2558 Nipple Tortured By Beautiful Slut – Mio Futaba

  • mio futaba uncensoredcreampiehandjobheyzo
    • 2021-07-08
    144 min

    [NHDTB-549]Step-Sister Is Worried That Her Step-Bro's Massive Cock May Break Her Tiny Pussy But She Takes It In Anyways

  • censoredsisterNHDTBnatural highremonha to nakashimaNHDTB-549NHDTB5491nhdtb00549
    • 2021-07-09
    118 min

    [MIDE-950]The Simple Girl Given Magic Chems During a Late Night Work Shift by the Low-Life Manager She Hates and Made to Cum to the Point of Death. Sakura Miura

  • minamata sakura censoredbig titssingle workMIDEmoodyztanaka baconmoodyz divaMIDE-950MIDE950mide00950
    • 2021-08-12
    67 min

    Pacopacomama 081221_515 Let Me Buy The Underwear You’Re Wearing Right Now! : Sexy Black Lingerie Bra And Panties Sachiko Takahashi

  • amateur uncensoredpacopacomama
    • 2021-08-13
    477 min

    [OFJE-327]A Sleazebag Scene Of The Adultery Of An Extraordinarily Beautiful Married Woman: 50 Consecutive Shots And 8 Hours Of Pleasurable And Unfaithful French Kisses And Sex With Other Guys

  • saki okuda nami hoshino censoredbig titsOFJEs1 no 1 styleOFJE-327OFJE327ofje00327
    • 2021-08-15
    66 min

    SIRO-4536 [First Shot] [Lady Full Of Elegance] [Beautiful Big Tits Jd] An Intelligent College Student With A High Facial Deviation Value Appears. Riding A Man With An Excellent Waist And Climaxing Many Times .. AV Application On The Net → AV Experien

  • amateur censoredbig titsamateursirosiro-4536siro4536siro-4536
    • 2021-08-26
    124 min

    [FSDSS-271]外出NGっつーからヤルことなくてヤリまくってたらこんなんなっちゃいましたけど！？ 永瀬みなも

  • minase nagase censoredFSDSSfalenokei isoifaleno starFSDSS-271FSDSS2711fsdss00271
    • 2021-09-07
    51 min

    C0930 ki210907 Kiyomi Nonaka 24years old

  • amateur uncensoredc0930
    • 2021-09-10
    121 min

    [VEC-492]I Brought Home This Beautiful Married Woman Who Works With Me At My Part-Time Job And Had Creampie Sex With her Nanami Matsumoto

  • nana matsumoto censoredcreampiebig titsVECvenuskaniemegami venusVEC-492VEC492vec00492
    • 2021-09-24
    40 min

    359TYVM-193 I Can’t Be Satisfied With My Husband Alone! Begging For A Vaginal Cum Shot While Being Ashamed Of A Frustrated Wife!

  • amateur censoredcreampiemarried womantyvmtyvm-193tyvm193359tyvm-193
    • 2021-09-25
    140 min

    [MCSR-452]How Many Wive"s Pussies Can I Fill With My Cum？ Hikari Sena

  • hikari sena censoredcreampiebig titsMCSRbigmorkalmasukattoMCSR-452MCSR45257mcsr00452
    • 2021-10-01
    151 min

    [MIAA-504]Cheating On My Wife With The Most Beautiful And Obscene Top Class Hostess, Who Makes Me Lose My Mind And Cum Inside Her Starring Mina Kitano

  • mina kitano censoredcreampiebig titsMIAAmoodyzmamezawa mametarouminna no kikatanMIAA-504MIAA504miaa00504
    • 2021-10-27
    64 min

    FC2PPV 2376230 * Limited Time Special Price & Bonus * [Peculiar Strong Woman ＃ 020] Gachiyaba Delusional Habit A Sober 24-Year-Old Dental Hygienist. Seeding Training That Is Violated By A Mess After The Wedding Of A Former Boyfriend And Is Crazy S

  • amateur uncensoredfc2



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies