javcensored jav censored delusion group mini system




FC2CJODSSNIAUKGSTARSHZGDMILKVENXMARACHRVMIAAAWDGVHWAAAPPPDMEYDABWMVSDAPODEBODNGOD

2023-08-12
124 min

SORA-475 Using The Formula Of "pi X Radius X Girl", Find A Solution To The Reiwa Version Of Kaguya-hime, Who Becomes Homeless With Debt And Has No Choice But To Live In A Drum Kana Yura

  • yura kana censoreddeepthroatsingle workSORAmountain and sky delusion groupkomatsu seventeenmountains and skySORA-475SORA475sora00475
    • 2023-06-17
    142 min

    NCYF-024 Gachi 7P Super Orgy! Miraculous Minimum Shaved Pussy Beautiful Girl Layer 18 Years Old Naive Vagina Tearing On The Thick Penis Of The Sticky Cameco Group [Crying Convulsions Bottomless Acme] The Best Adolescent Body Immediately After Graduat

  • censoredcreampiecosplayNCYFall japan kameko cooperative delusional groupudagawaall japan kameko cooperative mousouzokuNCYF-024NCYF024ncyf00024
    • 2021-12-18
    189 min

    [TNOZ-010]Short Height 140cm TSUNDERE Beautiful Girl In Cosplay (Gorgeous Face That Gets Lost In Pleasure And Spraying Pee For Top Tier Masochism) (French Kissing Everyone With Lots Of Saliva And Face-fucking Pleasure) Shaved Pussy Gets Intense Non-s

  • censoredcreampiesquirtingTNOZzennihon kameko kyoudou kumiai mousozokunidaime tsubanomi ojisannidaime tsubanomi ojisan mousozokuTNOZ-010TNOZ010tnoz00010
    • 2021-12-18
    115 min

    [NCYF-014]Crazy 8-person Orgy! Short Height 140m 18 Year Old Beautiful Girl In Elf Cosplay. Barely Legal With A Pure White Body For Intense Amateur Photo Group Session "That"s Enough, I"m Cumming!" (Bent Over To Get Fucked For A Craze

  • censoredcreampiecosplayNCYFall japan amateur photographers union daydream fantasy loversudagawaNCYF-014NCYF014ncyf00014
    • 2021-12-17
    120 min

    [FOCS-042]Chapter 2 A Reunion With Lala (Height: 142cm)! Why Is This Angel, Brimming With Hope, Here ...？ "Thank You For Everything You"ve Done For Me ..." This Girl Who Dreamed Of Big Things Had Her Spirit Crushed, But Now She Was Back A

  • lara kudo censoredbeautiful girlsingle workFOCSabc mousouzokufocusFOCS-042FOCS042focs00042
    • 2021-10-23
    146 min

    [PCDE-013]A Video Record Of The Activities Of A Certain Otaku 13

  • igarashi yui natsuhara censoredcosplayPCDEcp denen mousouzokucp denentoaru otaku no katsudou kirokuPCDE-013PCDE013pcde00013
    • 2021-09-18
    100 min

    [SUJI-142]S*****t Ten Gets A Dirty Creampie Or Two From The Father And The Brother Of Her Friend

  • hasumiten censoredcreampiesingle workSUJIkan ran monoSUJI-142SUJI142suji00142
    • 2021-09-17
    124 min

    [FOCS-021]Innocent 143cm Beautiful Girl From Abroad. "I"ve Made It To Japan" She Awakens To New Sexual Pleasures After Getting Used By Crazed Horny Men. Konomi Kimino

  • konomi kimino censoredsingle workFOCSabc mousou zokufocusFOCS-021FOCS021focs00021
    • 2021-08-13
    123 min

    [FOCS-016]I Met This 142cm Girl Overseas. Recruiting An Innocent Angel First Video! South East Asia Sex Trip Rara Kudo

  • lara kudo censoredblowjobbeautiful girlFOCSabc mousou zokufocusFOCS-016FOCS016focs00016
    • 2021-07-23
    124 min

    [NCYF-012]Seven People In A Wild Orgy: Otherworldly Petite Fairy Cosplayer With A 140 cm Tall Body Has Her Innocent Tight Pussy Destroyed By Thick Rods. "Shaved Pussy Breaching With Spraying Squirt", "Mixed Cum Pregnancy Experiment",

  • censoredcreampiesquirtingNCYFall japan amateur photographers union daudagawaNCYF-012NCYF012ncyf00012
    • 2021-06-17
    110 min

    [NCYF-011]A Serious Five-Way Large Orgies Fuck Fest! Meet A Beautiful Girl Cosplayer Who Stands 130cm Tall And Has A Teeny Tiny Body! "You're Going To Break My Pussy!" We're All Taking Turns Shoving Our Big Fat Cocks Into Her Tiny Rig

  • censoredcreampiesquirtingNCYFall japan amateur photographers union daudagawaNCYF-011NCYF011ncyf00011
    • 2021-05-15
    193 min

    [TNOZ-005]This 147cm-Tall, 18-Year Old Home Cosplayer Girl Who Lives In The Country Loves To Read Boys Love Mangas (Scream-Filled Shaved Pussy Spasmic Pissing Geysers) (5 Ejaculated Semen Shots Injected Into Her Pussy) A Six-Way Maso Bitch-Transformi

  • censoredamateurcosplayTNOZall japan amateur photographers union daspit uncle 2 all japan kameko cooperatiTNOZ-005TNOZ005tnoz00005
    • 2021-04-15
    121 min

    [SUJI-132]Female S*****t Live Room Feed Shaved Pussy Squirting Masturbation

  • censoredschoolgirlSUJIkanranshaSUJI-132SUJI132suji00132
    • 2021-04-15
    119 min

    [NCYF-010]Real 7-Person Orgy! Teeny Tiny Barely Legal Babe With A Shaved Pussy - Beautiful Girl Cosplayer "Your Cock Is So Huge, It's Going To Wreck Me" Her Delicate, Petite Pale Body Looks Like Angel - Now Transformed Into A Cum Dumpster

  • censoredcreampieNCYFall japan amateur photographers union daudagawaNCYF-010NCYF010ncyf00010
    • 2021-04-15
    88 min

    [SUJI-133]This ** S*****t Was Ravaged By The Desires Of Men Creampie Raw Footage Mao

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-133SUJI133suji00133
    • 2021-03-19
    120 min

    [SUJI-130]Stepdaddy's A Pervert! Filthy Acts Continuously Committed On His Beloved Stepdaughter

  • censoredcreampieSUJIkanranshaSUJI-130SUJI130suji00130
    • 2021-03-13
    180 min

    [KDKJ-107]A Virgin And A Cherry Boy Haname Wakamatsu

  • wakamatsu licking censoredsingle workKDKJkindan no kajitsu mousouzokuKDKJ-107KDKJ107kdkj00107
    • 2021-02-19
    96 min

    [SUJI-129]Selfish S*****t Chiharu Is Men's Desire

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-129SUJI129suji00129
    • 2021-02-19
    120 min

    [SUJI-128]Creampie Sex With A Pure, Obedient, Beautiful Girl

  • censoredcreampieSUJIkanranshaSUJI-128SUJI128suji00128
    • 2021-02-07
    128 min

    [PKPD-130]Cum Guzzling Class's Hikari-chan - Hey Mister, Wanna Play？ We Found A Barely Legal Slut (18) At The Neighborhood Park That'll Take Your Creampie Hikari Nozomi

  • hope light censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-130PKPD130pkpd00130
    • 2021-01-31
    119 min

    [BAB-024](Recruited Through Deceit) The Cutest, Youngest Girl We've Had.

  • censoredsquirtingamateurBABbabylon daydreamersBAB-024BAB024bab00024
    • 2021-01-24
    120 min

    [AGAV-047]This Natural Airhead Lolita Babe Has The Greatest I-Cup Colossal Tits I Oiled Up This Fully Clothed Princess' Titties And Satisfied Myself From All Angles And Now My Life Is Complete Hana Himesaki

  • himesaki hana censoredbig titsblowjobAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-047AGAV047agav00047
    • 2021-01-24
    132 min

    [OPPW-082]You're My Dress-Up Doll Sakuya Yuki

  • sakiya yuki censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-082OPPW082oppw00082
    • 2021-01-01
    129 min

    [PKPD-126]Sugar Daddy Dating - 18-Year-Old Willing To Take Creampies - Guaranteed To Get Wet Mona Amemiya

  • amemiya mona censoredcreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-126PKPD126pkpd00126
    • 2020-12-21
    131 min

    [AGAV-043]She's Got A Full Body Erogenous Zone! - Watch Her Wiggle And Jiggle Her G-Cup Titties And Cum Like Crazy While You Keep On Shooting Off Cum Shots! - Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-043AGAV043agav00043
    • 2020-12-06
    158 min

    [SORA-285]This Maso And Lusty And Aggressive Lolita Little Bitch Is Prepared To Be Shamed And Volunteering For Breaking In Training! (She Wants To Expose Her Pig-Faced Shame) (Deep Reverse Irrumatio) (Big Dick Threesome G*******ging Sex) (Shameful Go

  • chiharu miyazawa censoreddeepthroatsingle workSORAyama to sorausubashisuiSORA-285SORA285sora00285
    • 2020-10-25
    109 min

    [AGAV-037]Nipple Play Technique Of A Slut Who Makes Older Men Cum - Momoka Nakazawa

  • nakazawa momoka censoredschoolgirlslutAGAVsex agent daydreamersminimal iwamurasex agentAGAV-037AGAV037agav00037
    • 2020-09-27
    130 min

    [KDKJ-105]Light Skinned Beautiful Girl Walking Around With No Bra

  • censoredbeautiful girlKDKJkindan no kajitsu mousouzokuKDKJ-105KDKJ105kdkj00105
    • 2020-09-18
    134 min

    [SORA-268]A Girl With Small Tits Who Is Just Too Sensitive - Mio-chan

  • censoredSORAyama to soratrippyySORA-268SORA268sora00268
    • 2020-08-23
    112 min

    [AGAV-033]Little Demon Total Domain Girl. - Slut Urara Makes Masochist Guys Cum Huge Loads In 3 Scenes - Urara Kanon

  • hanaoto urara censoredbeautiful girlslutAGAVsex agent daydreamersspilma boysex agentAGAV-033AGAV033agav00033
    • 2020-07-20
    180 min

    [AMOZ-055][Girls Squirting And Wetting Themselves] 12 People III

  • censoredsquirtingblowjobAMOZamateur box daydreamamateur boxAMOZ-055AMOZ055amoz00055
    • 2020-07-05
    130 min

    [SOTB-008]I Was Bullied And So I Became Depressed And I Grew Up A Cherry Boy With A Warped Sense Of Sex. And My C***dhood Friend Was The Only Person Who Cared For Me. But The Only Way I Could Repay Her Kindness Was To Silently Fuck This Gentle And Na

  • sunflower censoreddeepthroatsingle workSOTByama to soratrippyyin the doorwaySOTB-008SOTB008sotb00008
    • 2020-06-28
    130 min

    [RANY-003]I LOVE TO FUCK I Love A Girl In A School Swimsuit Kanon ** Years Old Kanon Ichikawa

  • kanon ichikawa censoredcreampiesingle workRANYrainy daydream tribesnorioRANY-003RANY003rany00003
    • 2020-06-07
    146 min

    [SOTB-004]After Having A Vision In A Dream That I Can Only Live For 10 More Days I Met A Run-away Girl Looking For Somone To Save Her Ichigo Suzuya

  • suzuya strawberry censoredsingle workdramaSOTByama to sorahimu lockin the doorwaySOTB-004SOTB004sotb00004
    • 2020-06-07
    130 min

    [ANCI-037]The Daily Sexual Life Of A Hotly Rumored Blonde Young Female Athlete Dripping Wet Hardcore Sex Training With Japanese Men

  • censoredANCIspartan mousouzokutomohiro abespartanANCI-037ANCI037anci00037
    • 2020-05-31
    118 min

    [RANY-002]I LOVE FUCKING Dark Fall A Barely Legal Babe Falls To The Dark Side Himari-chan Himari Hina

  • hina himari censoredsingle workRANYrainy daydream tribesbirdman teppeiRANY-002RANY002rany00002
    • 2020-05-10
    242 min

    [KDKJ-102]Forbidden Fruits Hikaru Minazuki 4 Hours

  • hikaru minazuki censoredsingle workKDKJkindan no kajitsu mousouzokuKDKJ-102KDKJ102kdkj00102
    • 2020-05-10
    125 min

    [KDKJ-101]A Pale Mirage A Video Record Of A Girl's Sexual Growth Hiyori Suzuno

  • hiyori suzuno censoredsingle workKDKJkindan no kajitsu mousouzokuKDKJ-101KDKJ101kdkj00101
    • 2020-04-05
    113 min

    [SOAN-046]A Barely Legal Girl Breaks The School Rules! - A Rough Sex Anal Threesome That Leaves Her Asshole Gaping Wide And Desperate For More! - Marie-chan

  • censoredschoolgirlSOANyama to sorausubashisuianal visitSOAN-046SOAN046soan00046
    • 2020-03-29
    84 min

    [BAB-006]Standard Preferectural Department: Mi-chan

  • censoredbeautiful girlBABbabylon daydreamersBAB-006BAB006bab00006
    • 2020-03-22
    121 min

    [DARU-007]Chrysalis: Mei Tachibana

  • mei tachibana censoredcreampiesingle workDARUdarumax daydream tribeDARU-007DARU007daru00007
    • 2020-03-22
    132 min

    [AGAV-017]A Barely Legal Girl Gets Tied Up And Has Infinite Orgasms - Tsugumi Mizusawa

  • tsugumi mizusawa censoreddeepthroatsingle workAGAVsex agent daydreamersminimal iwamurasex agentAGAV-017AGAV017agav00017
    • 2020-03-01
    158 min

    [JMTY-023]Loser Girl Lab Time This Loser Girl Who Never Made Much Of An Impression In Class Is Here After School, Playing With A Dirty Old Man Until Her Curfew.

  • censoredcreampieuniformJMTYteacher mousouzokuno directorno labelJMTY-023JMTY023jmty00023
    • 2020-02-23
    129 min

    [BLOR-139]At First Glance, She's An Innocent Natural Airhead, But The Truth Is That She's A Horny Bitch Who's Hobbies Are "Experimenting With Cocks!" Through Big Cocks, Spankings, And Choking Sex, She's Spasming And Getting H

  • censoredBLORbroccoli mousouzokubroccolibroccoliBLOR-139BLOR139blor00139
    • 2020-02-02
    164 min

    [SOJU-020]She Had A Dream That She Would Only Have 10 More Days To Live I Met A Runaway Girl Who Was Looking For Divine Help Aya Nakamori

  • aya nakamori censoredsingle workdramaSOJUyama to sorahimu lockno labelSOJU-020SOJU020soju00020
    • 2020-02-01
    124 min

    [JMTY-020]A Sexual Apprenticeship Sena 18 Years Old 143cm Tall She's Working To Help Her Family Sena Ninomiya

  • sena ninomiya censoredcreampiesingle workJMTYteacher mousouzokuno directorno labelJMTY-020JMTY020jmty00020
    • 2020-01-26
    90 min

    [HIKR-153]I Thought I'd Be Lonely Forever... - One Day I Started Living With A Girl Who Can't Speak - She Likes Drawing Pictures - I Taught Her To Have Fun With My Cock

  • censoredbeautiful girlHIKRhigh kara mousouzokuno directorHIKR-153HIKR153hikr00153
    • 2020-01-16
    121 min

    [PTKS-072](Two Title Special) Japan Fucks! Blonde S********l Gets Banged At Night! & Russian Blondie Looks Bangin' In the Nude!

  • censoredbeautiful girlPTKSabc mousouzokuno directorpatsukinPTKS-072PTKS072ptks00072



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies