jav censored javcensored high vision other fetish




FC2AVSASDABGVHCJODFSDSSKSBJHUNTBROYDHDKASSISAUKSMVSDNATRWAAACAWDAWDSANPREDADNRBD

2019-01-10
185 min

[EQ-436]Old Ladies! Please Pump My Cock! Mature Woman Ladies Who Lust For Masturbating Men 4

  • censoredbig titsamateurEQbullittshinobu kamezushameEQ-436EQ436h-100eq00436
    • 2019-01-10
    133 min

    [RCTD-184]Sexy Ass Babe Stuck In The Train Door At The Mercy Of Horny Brats

  • shiiba mikuru sumire kurokawa censoredRCTDrocketscarecrowRCTD-184RCTD1841rctd00184
    • 2019-01-10
    181 min

    [RHE-639]When We Were Alone Working Overtime Together, My Mature Woman Colleague Started Getting Hot And Horny Peeping On Office Sex With With A Voluptuous Older Lady With An Erotic Ass

  • censoredbig titsmature womanRHEhot entertainmenthachiman kobayashiRHE-639RHE63959rhe00639
    • 2019-01-10
    241 min

    [RHE-635]Embarassed Mature Women's Masturbation Viewing 4 Hour Special 4

  • censoredblowjobmature womanRHEhot entertainmentmamorudish the fetishRHE-635RHE63559rhe00635
    • 2019-01-10
    133 min

    [RCTD-183]STOP! FAST! SLOW! Lowlife With The Ability To Control Time

  • kana morisawa kanako iioka aika mirei censoreduniformRCTDrocketkiyoshi miwaRCTD-183RCTD1831rctd00183
    • 2019-01-10
    93 min

    [OKP-027]Divine Pantyhose Sora Kamikawa We're Bringing You A Married Woman, A Mother, A Hard-Working Office Lady In Uniform, And Other Mature Woman Babes With Beautiful Legs Wrapped In Naughty And Nasty Pantyhose For Fully Clothed Musty Sniffing

  • kamikawa starry sky censoredmature womansingle workOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-027OKP0271okp00027
    • 2019-01-08
    115 min

    [ARM-730]For Passive Guys Who Want To Jerk Off To Panty Shots. Panty Shots By Request 2

  • nanako miyamura satori fujinami censoredbeautiful girlARMaroma kikakuupdatingaromaARM-730ARM730arm00730
    • 2019-01-02
    120 min

    [GVG-798]Naughty Nurses Kanna Abe

  • rena abe censoredsingle workdramaGVGglory questkoichi takahashiGVG-798GVG79813gvg00798
    • 2019-01-01
    133 min

    [NITR-426]Addicted To Sloppy Kisses And A Filthy Body II Shizuku Kimino

  • your spear censoredbig titscosplayNITRcrystal eizobobo ikebukuronitroNITR-426NITR42649nitr00426
    • 2019-01-01
    121 min

    [TUE-084]A Video Record Of A Private Film Session Of S*****girl Fetish Sex

  • censoredcreampieschoolgirlTUEglay zteitora eizoTUE-084TUE08412tue00084
    • 2019-01-01
    138 min

    [MARA-042]Hikari Misumi In The Colossal Tits Theater 104cm H-Cup Titties

  • hikari mizusumi censoredcreampiebig titsMARAplanet plusbirdman teppeimarakasMARA-042MARA042h-237mara00042
    • 2018-12-30
    150 min

    [KTSB-013]Molestation Is The Only Masturbation Material I Need! The Sensitive Office Lady Yui Looks Like A Quiet Girl But She Masturbates While Fantasizing About Being Molested! The Dirty Girl Keeps Asking For More Cum

  • censoredbukkakeKTSBkahanshin tigers mousouzokukahanshin tigersKTSB-013KTSB013ktsb00013
    • 2018-12-30
    165 min

    [CHAE-012]A Voluptuous Schoolgirl In Bloomers Yui Tomita

  • yu tomita censoredschoolgirlslutCHAEdigital arkflavaCHAE-012CHAE012chae00012
    • 2018-12-30
    240 min

    [DVDMS-351]A Big Cock Quickie Fuck With A Tight Ass Old Lady From My Neighborhood! 2 When She Got Forcefully Fucked And Teased With Pull Out Piston Pumping Action From A Handsome Seductive Man, This Beautiful Married Woman Reawakened The Womanly Lust

  • censoredamateurDVDMSdeep sswing nagaseDVDMS-351DVDMS351dvdms00351
    • 2018-12-30
    130 min

    [KAGP-076]May I Give You An Anal Licking？ Amateur Girls Who Cum With Their Asses

  • censoredanalamateurKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-076KAGP076kagp00076
    • 2018-12-30
    123 min

    [MGMP-039]This Cleaning Lady Slut Is Giving A Rubber Glove Handjob Maso Ejaculation Washup!

  • yua aisaki mandarin orange censoredsluthandjobMGMPmegamibeautiful goddess premiumMGMP-039MGMP039mgmp00039
    • 2018-12-29
    224 min

    [HUNTA-536]I Got Super Excited For A Young Wife With A Beautiful Ass And She Kept Thrusting Her Tight Ass Out At Me!! I Joined A Yoga Class And To My Surprise, I Was The Only Man In Class!？ Everywhere I Looked, All I Could See Were Hot And Tight Asse

  • censoredHUNTAhuntercognac kaminohhh groupHUNTA-536HUNTA536hunta00536
    • 2018-12-29
    178 min

    [OYC-226]This Woman Was The Victim Of Repeated Sexual Harassment Committed By An Instructor In The Locker Room Of Her Sports Gym At First She Refused His Advances, But Day By Day, She Began To Enjoy The Thrill, And Finally She Started To Rub Her Tigh

  • censoredcreampieOYCoyashoku.companytoguro sistershhh groupOYC-226OYC226oyc00226
    • 2018-12-29
    182 min

    [SSNI-380]Total Domain: Tempting Glances of Moe Amatsuka's Heavenly, Smooth Thighs

  • angel moe censoredbeautiful girlslutSSNIs1 no 1 stylegoemonSSNI-380SSNI380ssni00380
    • 2018-12-28
    129 min

    [NED-003]I'm Cumming To Rape Your Nipples. Maria Osawa

  • maria serizawa censoredbig titsslutNEDdream ticketsamoariNED-003NED00324ned00003
    • 2018-12-28
    117 min

    [HZGD-099]While My Husband Is In The Bath... My Nephew "Raped Me, Made Me Orgasm And Impregnated Me" KAORI

  • kaori censoredcreampiebig titsHZGDmarried woman flower garden theaterzaku araiHZGD-099HZGD099h-1100hzgd00099
    • 2018-12-28
    239 min

    [OKAX-456]This Molester Is Glomming On To An Old Lady Who Works At A Hot Springs Hotel 4 Hours

  • censoredbig titsmature womanOKAXk m producedick mandokuokazuOKAX-456OKAX45684okax00456
    • 2018-12-28
    241 min

    [OKAX-453]Hot Pranks On A Nurse And Her Horse-Sized Ass An Undercover Molester Invasion Of A Hospital 4 Hours

  • censoreduniformamateurOKAXk m producedick mandokuokazuOKAX-453OKAX45384okax00453
    • 2018-12-27
    240 min

    [AIMA-001]Footjob Ejaculation. 16 Beautiful Women Jerk You Off With Their Feet Until You Cum. 4 Hours

  • censoredAIMAmercuryanimaAIMA-001AIMA001h-1133aima00001
    • 2018-12-27
    119 min

    [SKMS-002]The J-Cup MILF We Picked Up At The Park Watch Her Suck Filthy Cock Like A Bitch Mikuru Shiiba

  • shiiba mikuru censoredslutsingle workSKMSmercurysukima industriesSKMS-002SKMS002h-1133skms00002
    • 2018-12-22
    148 min

    [JUFE-008]Twitching And Trembling Sweaty Dripping Wet Anal Sex! She's Mounting Her Man And Furiously Shaking Her Butt In Degrading Slut Ass Sex Manami Kudo

  • manami kudo censoredslutsingle workJUFEfitchJUFE-008JUFE008jufe00008
    • 2018-12-21
    245 min

    [DOCP-112]The Sexy Woman With A Beautiful Ass Shows Off Her Butt Bra And Seduces Me

  • yu tomita maria serizawa censoredlingerieDOCPprestigedoc premiumDOCP-112DOCP112118docp00112
    • 2018-12-21
    133 min

    [DOKS-463]Perverted Nose Jobbing Girls Are Getting Horny For The Scent Of Stinky Cock Scum

  • risa asai yumeno misaki censoredhandjobDOKSoffice k somaruDOKS-463DOKS46336doks00463
    • 2018-12-20
    157 min

    [NHDTB-216]Molesting Teachers Make Knee High Schoolgirls Legs Twitch Exposed With Several Egg Vibrators 2

  • censoredschoolgirlNHDTBnatural highkansukeNHDTB-216NHDTB2161nhdtb00216
    • 2018-12-20
    127 min

    [NEO-668]Unresisting Babe With Cute, Troubled Face Gets Covered In Cum

  • miori hara censoredsingle workbukkakeNEOradixshio sakurabaneo radixNEO-668NEO668433neo00668
    • 2018-12-20
    93 min

    [OKP-026]Divine Panty Hose. Shuri Atomi. Married Women, Mothers, Working Office Ladies In Uniform, Etc. Savor Their Pantyhose From The Moist Soles Of Their Feet To Their Toes! Masturbation, Facesitting, Footjobs, Creampies, And Buttjob Bukkake- Anyth

  • atomi shuri censoredmature womansingle workOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-026OKP0261okp00026
    • 2018-12-20
    120 min

    [RCTD-177]An Asshole-Spreading First Airline

  • akemi miu hamazaki mao censoredanalRCTDrocketroute yamazakiRCTD-177RCTD1771rctd00177
    • 2018-12-20
    140 min

    [STARS-014]Mana Sakura When She's Fucked By A Big Dick And Orgasms With Her Big Ass In Full View, Her Asshole Tightens

  • mana sakura censoredanalsingle workSTARSsod createkaorusod starSTARS-014STARS0141stars00014
    • 2018-12-19
    120 min

    [GVG-794]Father In Law and Daughter In Law, Secret Creampie Fucking Manami Oura

  • manami oura censoredcreampiesingle workGVGglory questtsunemori takahashiGVG-794GVG79413gvg00794
    • 2018-12-19
    125 min

    [GVG-795]Mio Kimijima And Gross Guys' Passionate Licking Family Mio Kimijima

  • kimishima mio censoredbig titsblowjobGVGglory questGVG-795GVG79513gvg00795
    • 2018-12-19
    130 min

    [GVG-797]Village Doctor Old Man Face Licking Creampie Pervert Clinical Chart Yuna Ishikawa

  • yuna ishikawa censoredcreampiesingle workGVGglory questrokusaburo mishimaGVG-797GVG79713gvg00797
    • 2018-12-17
    148 min

    [FLAV-211]HYPER FETISH A Naughty Queen In A High Cut Outfit Yurika Aoi

  • yurika censoredbig titssquirtingFLAVdigital arkdigital ark digital arkFLAV-211FLAV211flav00211
    • 2018-12-17
    132 min

    [FLAV-210]Sex With A Seductive Schoolgirl With A Big Ass In A School Swimsuit. Slender Body With A Small Waist And Big Ass. 94cm Hip. Yukine Sakuragi

  • yuki sakuragi censoredschoolgirlslutFLAVdigital arkdigital ark digital arkFLAV-210FLAV210flav00210
    • 2018-12-16
    116 min

    [JUY-713]Mr. Sakai Is The Perfect Boss. But He's Secretly Obsessed With Big Butts... Yui Miho

  • miho yui censoredbig titsmature womanJUYmadonnaeitaro hagaeJUY-713JUY713juy00713
    • 2018-12-14
    130 min

    [SABA-486]Make Me Lick And Slurp Your Asshole Perverted Amateurs Who Love To Lick Anal Holes Are Making Their Adult Video Debuts

  • censoredanalamateurSABAskyu shirotoSABA-486SABA486h-244saba00486
    • 2018-12-14
    164 min

    [XRW-607]A Woman Who Loves To Suck Cock Misuzu Kawana

  • misuzu kawana censoredblowjobslutXRWreal worksani nakamurareal real worksXRW-607XRW607172xrw00607
    • 2018-12-14
    120 min

    [XRW-614]This Young Wife Is Unconsciously Getting Men Excited With Her Bra Slippage And That's Why She Got Raped Yu Amaki

  • yu amagi censoredcreampielingerieXRWreal worksreal real worksXRW-614XRW614172xrw00614
    • 2018-12-14
    130 min

    [GETS-099][*Shocking Turn Of Events] The Neighbor's Wife Came To Visit Me In A Dripping Wet Maxi Dress And Tempted Me! Her Bra And Panties Showing Through Her Wet, Clinging Clothes Made Me So Hard, I Lost Control And Pushed Her Down... And Someth

  • censoredslutGETSprestigescoreGETS-099GETS099118gets00099
    • 2018-12-14
    305 min

    [SABA-481]An Amateur Nude Pictorial A Highly Educated College Girl

  • censoredamateurSABAskyu shirotoSABA-481SABA481h-244saba00481
    • 2018-12-14
    138 min

    [VRTM-397]We Discreetly Stroked Wives' Pussies Under the Kotatsu Table and They Got Soaking Wet! It's Been So Long They Cum Over and Over Even Though Their Husbands Are Next to Them! 3

  • anne mashiro natsuko mishima censoredcreampiebig titsVRTMv r producegoro koenjiVRTM-397VRTM397h-910vrtm00397
    • 2018-12-14
    240 min

    [UMSO-223]All You Need Is Courage! Picking Up Working Women Special. Izakaya, Hostess Bar, Karaoke Bar Workers. 12 Women, 4 Hours

  • censoredcreampiebig titsUMSOk m produceumanamiUMSO-223UMSO22384umso00223
    • 2018-12-13
    70 min

    [GEKI-009]Turned On By The Ass Of A Barely Legal Girl In Gym Shorts, I Had To Fuck Her Right There And Then! She Can't Escape The Big Cock And Intense Fucking, She Convulses And Orgasms! It's Rare To Find A Girl Who Still Likes To Wear Gym Sh

  • sakaegawa noa censoredschoolgirlsingle workGEKIan amazingly rare amateurpeace makerGEKI-009GEKI009geki00009
    • 2018-12-13
    216 min

    [HUNTA-530]I Got A Job At A Day Care Center And I'm The Only Man!？ The Nursery Teachers' Asses In Tight Pants Turn Me On!! When I Look Around The Busy Day Care Center, All I See Are Nursery Teachers In Tight Pants, They're So Sexy! Workin

  • censoredHUNTAhuntercognac kaminohhh groupHUNTA-530HUNTA530hunta00530



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies