iori nanase




FC2NACRGVHSANMEYDMIAASTARSHDKAMILKHMNWANZJULCJODBBANPREDJUFEAPODLULUSSISNGODDASD

2020-10-08
241 min

[SVDVD-820]Shame The New Female Teacher Was Turned Into A Sexual Teaching Tool At An All Boys School She Was Exposed In Front Of Her S*****ts And F***ed To Endure Their Insolent Fingers, Probing And Ravaging Her Pussy! Her Pride Was Destroyed, But No

  • marin natsuki yui kawai censoredcreampieblowjobSVDVDsadistic villageista girl and her shameSVDVD-820SVDVD8201svdvd00820
    • 2020-10-08
    20 min

    [100820-001]Anal Encyclopedia : Chiaki Hidaka

  • chiaki hidaka uncensoredanalcaribbeancom
    • 2020-10-09
    56 min

    [oretd-771]NANASEさん

  • amateur censoredcreampieamateuroretdoretd-771oretd771oretd-771
    • 2020-10-13
    135 min

    [MSFH-029]The Man Who Loves Her Is A Criminal Until The Moment Her Lover Turned Himself In, They Spent All Day Creampie Fucking Like Crazy Miko Mizusawa

  • mizusawa beauty censoredcreampiebig titsMSFHsod creategoemonms sodMSFH-029MSFH0291msfh00029
    • 2020-10-15
    58 min

    [orec-613]ひなた

  • amateur censoredbig titsamateurorecorec-613orec613orec-613
    • 2020-11-03
    140 min

    [SDJS-095]Saying Her Plumbing's Broke... My Colleague From Work Came To Stay At My Place For 3 Nights And 4 Days. Although She Acts Cold At Work She Gets Really Clingy When It's Just The Two Of Us... The Secret Tsundere Life - SOD Female Empl

  • miyazaki rin censoredamateurbeautiful girlSDJSsod createsuisei akaisod female employeeSDJS-095SDJS0951sdjs00095
    • 2020-11-06
    103 min

    [RBD-994]Servant Island Special Edition - Kanna Misaki

  • kanna misaki censoredsingle workRBDattackersnagira kenzoryupakuRBD-994RBD994rbd00994
    • 2020-11-07
    76 min

    H4610 ki201107 Gold Pack 20years old

  • amateur uncensoredh4610
    • 2020-11-19
    150 min

    [SSNI-921]*Completely uned!! POV!! No Makeup! Anything Goes! Mei Washio's Real Honest Perverted Sex Life!! Super Rare 200 Erotic Raw Footage Of A Couple's Hot Spring Trip Full Of Fucking

  • mei washio censoredbig titsbeautiful girlSSNIs1 no 1 stylehirokoji osakiSSNI-921SSNI921ssni00921
    • 2020-11-19
    144 min

    [TSF-008]A Super Otaku Man (Age: 28) Transforms Into A Woman, And We Investigate Thoroughly He/She Was In Full Maso Mode, So When We Decided To Tease Him/Her, He/She Started Begging, "Please Fuck Me, Now" So We Obliged And Made Him/Her Cum Li

  • toyohiro tanabe censoredcreampiesingle workTSFkaguyahimept mousouzokugynecomastia reportTSF-008TSF008tsf00008
    • 2020-11-23
    120 min

    [KCDA-291]Vibrator Ecstasy - Pretty Face Twisted With Orgasmic Pleasure 15 Times

  • censoredbig titsslutKCDAdigital arkdigital ark digital arkKCDA-291KCDA291kcda00291
    • 2020-11-24
    57 min

    C0930 ki201124 Fuyumi Noguchi 18years old

  • amateur uncensoredc0930
    • 2020-11-26
    137 min

    [IENF-112]Horny Married Sluts Show You Just How To Please Them - Their Pussies Gush For G-Spot Stimulation - The Ultimate Orgasmic Masturbation

  • mihina azumihina mihina nagai sea sky flower censoredIENFienergyienfIENF-112IENF1121ienf00112
    • 2020-11-29
    130 min

    [KAGN-001]Amateur Girls Who Will Give Blowjob Action Anytime, Anywhere Friendly Double Blowjob Action 14 Girls

  • censoredamateurblowjobKAGNprincess kaguya pt delusional familywife s trapprincess kaguya ptKAGN-001KAGN001kagn00001
    • 2020-12-05
    61 min

    Caribbeancom 120520-001 Special Lesson After School: I was wet whole day even during classes at school..Mika Takagi

  • mika takagi uncensoredcreampiecaribbeancom
    • 2020-12-08
    140 min

    [KIRE-014]Rinka Tahara (35 Years Old Occupation: Married Woman) They Made Me Pose As A J* Model...

  • rinka tahara censoredbig titsuniformKIREsod createafro takahashiKIRE-014KIRE0141kire00014
    • 2020-12-25
    242 min

    [NASH-430]Conquer And Claim - Cheating Wives BEST Collection 4 Hours

  • censoredbig titsmature womanNASHnadeshikoNASH-430NASH430h-067nash00430
    • 2021-01-12
    78 min

    [BTHA-061]Hairy Nude - Non-edited: A Beautiful Girl With Beautiful Legs/A Princess With Beautiful Tits - Ichika Hoshimiya

  • ichika hoshimiya censoredbeautiful girlsingle workBTHAsupa kubijonBTHA-061BTHA0615433btha00061
    • 2021-01-20
    72 min

    259LUXU-1366 Luxury TV 1355 Bijin Yomimo applies for AV! Beautiful big breasts shine on a slender body! “What kind of feeling is it that people can see sex …” It is a must-see for a beautiful woman with outstanding transparency to spri

  • amateur censoredbig titsamateurluxuluxu-1366luxu1366259luxu-1366
    • 2021-01-30
    148 min

    [MIMK-083]Cuckolding A Wife Next Door With Aphrodisiacs: The First Collaboration Between Popular Manga Artist Ishito Yura And MOODYZ! Haru Kawamura

  • kawamura haru censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-083MIMK083mimk00083
    • 2021-02-06
    117 min

    [ADN-294]I Missed The Last Train Home - I've Got A Girlfriend, But I Ended Up Staying At My Boss's Place... Hikari Kisaki

  • hikari hime censoredbig titssingle workADNattackersnaotootona no dramaADN-294ADN294adn00294
    • 2021-02-12
    119 min

    [DASD-813]Big Booty Boss Tempted By Her Coworker Into Submissive Sex Waka Misono Yu Shinoda

  • misono waka shinoda yu censoredslutdramaDASDdasrokusaburo mishimaDASD-813DASD813dasd00813
    • 2021-02-18
    128 min

    [ROYD-041]I Took A Bath With My Stepsister For The First Time Since We Were K*ds, And... Nanami Matsumoto

  • nana matsumoto censoredcreampiebig titsROYDroyalkawajirihhh groupROYD-041ROYD041royd00041
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-27
    178 min

    [MIDE-888]Kiss Me Right Now: Twirl Your Tongue, Deep, Thick Kisses And Close-up Intercourse - Nana Yagi

  • nana yagi censoredbeautiful girlsingle workMIDEmoodyzusa pyonmoodyz divaMIDE-888MIDE888mide00888
    • 2021-03-03
    92 min

    FC2PPV 1709725 [Personal shooting / set sale] Two other sticks that the husband eats while taking his daughter to the hospital Complete version

  • amateur uncensoredfc2
    • 2021-03-27
    240 min

    [JKSR-486]"I Want You To Make Love To Me..." Horny, Innocent Wives Indulge In The Ultimate Carnal Sin: Adultery 14 Married Women, 4 Hours

  • mihina azumihina mihina nagai southern eyebrows censoredbig titsJKSRbig morkalprink junkyJKSR-486JKSR48657jksr00486
    • 2021-04-01
    148 min

    [GOJU-179]No Warning!! A Fifty-Something Mature Woman Who Came To Work A Blowjob Is Suddenly Providing Opportunities For Oral Ejaculation! 2

  • censoredamateurblowjobGOJUfifty somethingGOJU-179GOJU179h-1165goju00179
    • 2021-04-09
    167 min

    [MIFD-153]I Want To Draw My Own Sex! Fresh Face Porn Debut - Cute & Boyish Mai Kagari, Age 20

  • flower hunting censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-153MIFD153mifd00153
    • 2021-04-22
    35 min

    FC2PPV 1781383 [Uterine cramps dying hell] Let’s cry, scream, but squid! Never stop! A video for Does who wants to watch the uniform Lori being forced to squid and having an expression of agony all the time

  • amateur uncensoredfc2
    • 2021-04-22
    63 min

    SIRO-4499 [First shot] [Ubu daughter of withdrawal thought] [Erotic voice leaking] A serious girl who applied to change her inexperienced self. If you teach a naive body pleasure, make a cute voice .. AV application on the net → AV experience shootin

  • amateur censoredamateursirosiro-4499siro4499siro-4499
    • 2021-04-28
    51 min

    FC2PPV 1792607 A fresh slender girl who just came to Tokyo ❤️ First and last intense Gonzo video [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-01
    137 min

    [BF-631]Step Sister Gets A Boyfriend And Fucks Her Playboy Step Brother As Practice! He Gets His Dick Drained Dry By Her Pussy As She Rides Him Cowgirl Style Kurea Hasumi

  • hasumi claire censoredcreampieslutBFbefreeBF-631BF631bf00631
    • 2021-05-23
    66 min

    SIRO-4529 [First shot] [Arousing moist eyes] [Dirty erection nipples] A nursery teacher’s egg with a motherly smile makes her hidden sexual desire bloom. A nympho girl who seeks Chi Po with moist eyes pops the sexual desire accumulated in SEX fo

  • amateur censoredbig titsamateursirosiro-4529siro4529siro-4529
    • 2021-05-29
    59 min

    1Pondo 052921_001 Full body massage by a sailor cutie: Erika Shiomi

  • amateur uncensored1pondo
    • 2021-07-08
    125 min

    [GUN-856]Pulling the Nose Wide Open With the Hooks. Nana Maeno.

  • nana maeno censoredsingle workGUNradixsakuraba kyuu kokoro otokobatsugunGUN-856GUN856433gun00856
    • 2021-07-09
    54 min

    GERK-386 Asuka-chan

  • amateur censoredcreampieschoolgirlgerkgerk-386gerk386gerk-386
    • 2021-07-14
    239 min

    [HUNTB-053]The Two Of Us All Alone Together: I And My Slutty Stepsister Were Left Behind When Our Parents Transferred Overseas For Work! Live-In Lifestyle With A Cock-Devouring Monster Nympho With Just One Rule...

  • censoredschoolgirlsisterHUNTBhuntervolvo nakanohhh groupHUNTB-053HUNTB053huntb00053
    • 2021-08-25
    57 min

    491TKWA-188 Geki Kawa K-Kosyodol Enko Raw Creampie & Facial Cumshot 3P Video

  • amateur censoredcreampieuniformtkwatkwa-188tkwa188491tkwa-188
    • 2021-09-09
    115 min

    [PARM-168]An Easy Job That Just Involves Showing Off Your Panties

  • hinako mori hikaru konno censoredblowjobPARMaroma planningmoso chirarizumuPARM-168PARM168parm00168
    • 2021-10-08
    140 min

    [SSIS-197]奥田咲のPLATINUM SOAP

  • saki okuda censoredbig titssingle workSSISs1 no 1 styleoosaki hirokoujiSSIS-197SSIS197ssis00197
    • 2021-10-15
    122 min

    [PRED-348]"Sir, How Would You Like To Cum Today ...？" This Plain Jane Female Employee Made Abnormal Love To Me That Day, And Satisfied Her Lust, And Creampie Fucked Me To Oblivion. Runa Tsukino

  • tsukino luna censoredcreampieblowjobPREDpremiumeightelegancePRED-348PRED348pred00348
    • 2021-10-16
    89 min

    [DANDAN-009]I Met This Girl In An Online Game, And I Thought She Would Be A Plain Jane, But She Turned Out To Be A Bitchy Gal!! She Invited Me To A Private Room Izakaya Bar, And As We Were Fucking, She Continued To Tease Me, And When I Could No Longe

  • censoredcreampieblowjobDANDANdandykikujiro ozuDANDAN-009DANDAN0091dandan00009
    • 2021-10-16
    98 min

    230OREC-916 Ah-Chan (Asuka Momose)

  • amateur censoredamateurbeautiful girlorecorec-916orec916230orec-916
    • 2021-10-16
    81 min

    230OREC-912 Sora (Sora Inoue)

  • amateur censoredcreampieamateurorecorec-912orec912230orec-912
    • 2021-10-22
    138 min

    [PED-014]Considering That It Has Been Just The Two Of Us For Only 7 Hours...The Result Is That We Had Sex 10 Times. Ayaka Mochizuki

  • ayaka mochizuki censoredbig titssquirtingPEDdream ticketichinose kurumiPED-014PED01424ped00014
    • 2021-11-15
    527 min

    [ZAX-005]Secret, Deep Contact With Beautiful Sexy Woman!! S-Class Call Girl. Tried The Rumored Underworld Sex.

  • censoredcreampieamateurZAXpeters maxZAX-005ZAX005h-720zax00005
    • 2021-11-16
    138 min

    [TEN-038]Yukemuri NAWA-KOKOKU 1 Rei Kurugi

  • satoshi kuruki censoredbdsmsingle workTENvan associatestenma harutenmaTEN-038TEN038h-859ten00038



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies