humiliation big tits high vision censored creampie




FC2ATIDADNVENUBBANSQTEDASDHMNMIDEMEYDMARAPPPDAWDSTARSAUKGMILKAMBISANIPXRBDSSIS

2020-09-19
58 min

Caribbeancom 091920-001 Tame Ami : Will Be Your Dog Mika Sumire

  • mika sumire uncensoredcreampiecaribbeancom
    • 2020-09-28
    54 min

    [DHT-170]Reiko Kobayakawa Will Gently And Relentlessly Make You Cum A Cherry Boy Popping Documentary

  • censoredbig titsmature womanDHThot entertainmentkazuki madokaDHT-170DHT17059dht00170
    • 2020-09-29
    90 min

    384SHSS-005 Forgive me already! A whip whip white gal who sprinkles with a jerky foot

  • amateur censoredcreampieamateurshssshss-005shss005384shss-005
    • 2020-10-18
    96 min

    [MYBA-027]Married Woman Goes Wild Amina Sakashita

  • amina sakashita censoredmature womansingle workMYBAhitozuma engokai emmanuelleihyo kairoiMYBA-027MYBA027myba00027
    • 2020-10-28
    49 min

    FC2PPV 1549507 ★ Appearance ☆ Follower amateur man and erotic older sister Midoriko cum shot for the first time ☆ Grinning Midoriko looking at Bing’s big dick ♥ A large amount of semen cum shot at the end while squirming to the back of the vagin

  • amateur uncensoredfc2
    • 2020-10-28
    82 min

    [SIIN-020]純真無垢 浅野ゆあ

  • yua asano censoredSIINsidSIIN-020SIIN020h-816siin00020
    • 2020-10-31
    120 min

    [MIAA-341]I Hate That Middle-Aged Teacher, But When He Kisses Me With His Super Thick And Drooling Tongue, I Just Get So Excited... I Could No Longer Resist, As His Sweat, His Saliva, And His Drool Slid Down My Throat, As We Exchanged Bodily Fluids,

  • mitsuha higuchi censoredschoolgirlsingle workMIAAmoodyzgoemonminna no kikatanMIAA-341MIAA341miaa00341
    • 2020-11-01
    57 min

    324SRTD-0198 The celebrity office lady who applied was super erotic and was a master of blowjob w

  • amateur censoredamateursrtdsrtd-0198srtd0198324srtd-0198
    • 2020-11-07
    60 min

    SIRO-4321 [First shot] [Secrets of a maid cafe clerk] [Erogenous zone is left ear] Embarrassing, but I want you to see it. The whole story of a super cute naughty maid shaking with sex .. AV application on the net → AV experience shooting 1386

  • amateur censoredamateursirosiro-4321siro4321siro-4321
    • 2020-11-21
    50 min

    H0930 ki201122 Fumiko Manaka 40years old

  • amateur uncensoredh0930
    • 2020-11-23
    47 min

    IDJS-018 Seira

  • amateur censoredcreampieamateuridjsidjs-018idjs018idjs-018
    • 2020-11-26
    97 min

    [hoi-147]堀北(21)

  • amateur censoredamateurbeautiful girlhoihoi-147hoi147hoi-147
    • 2020-12-05
    171 min

    [URE-061]The Ultimate Hyponotic Seduction! Creator: Riku Aijo From The "Hypnotic Instructions" Series Comes Hypnotic Instructions 4: Instructions For Getting Girls Pregnant Maki Hojo And Ruka Inaba

  • hojo asahi inaba censoredschoolgirlmature womanUREmadonnakitorune kawaguchiure.comiURE-061URE061ure00061
    • 2020-12-18
    109 min

    [DDHH-023]Confinement - How I Became An Obedient Pet - Kanon Kanade

  • kanon kanon censoredschoolgirldeepthroatDDHHdogmahidekiDDHH-023DDHH023ddhh00023
    • 2020-12-25
    135 min

    [SGM-049]Housework Helpers In Tight Pants! - Beautiful Older Women Look So Sexy Doing The Cleaning! - Their Seductive Asses Are Just Begging To Get Fucked! - Helpers In Their 40's And 50's Provide Excellent Sexual Services - Chisato Shoda , I

  • shota chisato satoshi kondo satomi kondo censoredcreampiemarried womanSGMglobal media entertainmentjiro sadojimasuper global mediaSGM-049SGM049143sgm00049
    • 2021-01-09
    118 min

    [EBOD-793]Is She Emotionally Fucked Up？ Is She A Time Bomb Waiting To Go Off？ It Doesn't Matter, Because She's Super Sexy! Kurumi Momota Is An F-Cup Titty Angel Who Is Dangerous But Impossible To Ignore An E-BODY Debut

  • hyakuta walnut censoredbig titsbeautiful girlEBODe bodyyurukoEBOD-793EBOD793ebod00793
    • 2021-01-15
    237 min

    [SIM-105]"Hey Teacher, Let's Hurry Up And Fuck" This Private Tutor Is An Excessively Devilish Mofo Who Is Luring His Sch**lgirl Pupil To Temptation, And When They Fuck, He Doesn't Even Bother To Put On A Rubber, And Goes For A Totally

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-105SIM105118sim00105
    • 2021-01-23
    149 min

    [HND-943]This Pay-For-Play Gal Is Usually A Cold Fish During Sex, But When She Won The Lottery She Immediately Changed Her Tune! This Slut Kept On Begging For Creampie Sex While Earning Tips. Hina Nanami

  • hina nanami hina nanase censoredcreampieblowjobHNDhon nakausa pyonHND-943HND943hnd00943
    • 2021-02-03
    124 min

    [GVH-187]Anal Device Bondage XXII: Tied Up Anal Shame - Nozomi Arimura

  • arimura nozomi censoredanalsingle workGVHglory questGVH-187GVH18713gvh00187
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-13
    56 min

    C0930 ki210213 Request

  • amateur uncensoredc0930
    • 2021-02-22
    178 min

    [WNSK-002]After This, Will She Immediately Commit Infidelity!？ When I Saw My Girlfriend Defiled With Another Man's Semen, I Had A Melancholic Erection!!

  • censoredWNSKoneWNSK-002WNSK002wnsk00002
    • 2021-02-28
    130 min

    [JUTA-115]Ultimate! An AV Document Of The First Undressing Of A 30-something Wife - Reina Hirokawa

  • reina hirokawa censoredcreampieblowjobJUTAjukujo japanhachibee ikariJUTA-115JUTA115juta00115
    • 2021-03-13
    124 min

    [GMEM-025]Confinement! Ravishment! Screaming Orgasms! Breaking In An Elite Undercover Narcotics Investigator - Ruthless REVENGE - Toned, Trained Body Driven Mad With Lust AIKA

  • aika censoredsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-025GMEM025gmem00025
    • 2021-03-18
    220 min

    [HUNTA-971]"Please Untie Me ... This Is So Embarrassing" I Tied Up My C***dhood Friend In Special Knots That Are Impossible To Untie By Herself, And I Put Her In The Paradise Lock Position, And When I Saw Her Thrusting Her Super Erotic Ass Ou

  • censoredschoolgirlHUNTAhuntergorilla butahhh groupHUNTA-971HUNTA971hunta00971
    • 2021-03-19
    235 min

    [DOCP-281]Picking Up Girls On Tour! H

  • kawamura haru momose asuka censoredDOCPprestigedoc premiumDOCP-281DOCP281118docp00281
    • 2021-03-22
    122 min

    [MGMQ-069]Natural Devilish Daddy's Girl Seduces Her Kinky Masochistic Stepdad Yui Nagase

  • yui nagase censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-069MGMQ069mgmq00069
    • 2021-03-25
    65 min

    10musume 032521_01 Amazing Sex with A Former Japanese Punk Kid ! Kyoko Takagi

  • amateur uncensored10musume
    • 2021-03-27
    122 min

    [GONE-031]Hot Curvy Tanned Body - Grab Hold Of Yuri Honma 's Glamorous Booty And Pound Her Hard!

  • really censoredbig titssingle workGONEmercuryan erotic tanned elder sisterGONE-031GONE031h-1133gone00031
    • 2021-04-05
    113 min

    [SIS-125]Elder Sister Night Visit Creampie Peeping R**e

  • censoredcreampiesisterSISglay zsisterSIS-125SIS12512sis00125
    • 2021-04-08
    61 min

    [413INST-111]【爆乳OL・乱交個撮】個撮職人大集合！Kcupミラクル爆乳OL

  • amateur censoredcreampiebig titsinstinst-111inst111413inst-111
    • 2021-04-30
    74 min

    300NTK-561 Urgent insertion delivery! !! The bright erotic squirrel of a natural beautiful girl loved by God explodes! !! I tried to play with a happy bitch toy ♪ has started safely! !! It shouldn’t end with just a toy, and continuous ascension

  • amateur censoredcreampieamateurntkntk-561ntk561300ntk-561
    • 2021-05-14
    55 min

    518ASGM-002 [Sleep Fucking / Intravaginal Ejaculation] Intelligent Black Hair Beautiful Girl М (Saitama / Private / Selection Class) Estimated C Cup

  • amateur censoreduniformamateurasgmasgm-002asgm002518asgm-002
    • 2021-05-18
    58 min

    10musume 051821_01 Now, secretly experience the popular pour warm water on your back Kanon Okada

  • amateur uncensored10musume
    • 2021-05-29
    126 min

    390JAC-096 [Continuous Saddle Tide x 20-year-old Professional Student x Raw Saddle 4 Barrage] Pitch Pichi’s 20-year-old enters the freestyle SEX medley! Continuous splash with Saddle tide quick turn! !! Climax butterfly with strangling SEX! !! G

  • amateur censoredcreampiesquirtingjacjac-096jac096390jac-096
    • 2021-06-04
    149 min

    [SSIS-081]The Physical Therapist And The Suggestible S*********l In A Uniform Who Can't Say No Rena Kodama

  • kodama rena censoredbeautiful girlsingle workSSISs1 no 1 styleamazing meatSSIS-081SSIS081ssis00081
    • 2021-06-09
    131 min

    428SUKE-074 [Drunk x Beautiful Big Tits] MAYA-chan ★ Drunk from the meeting! ？？ I’ll have boobs that seem to overflow! !! Big Penis Cheeks Drooling w Sucking at Facesitting! !! All-in www [YORU ★ like.3]

  • maya censoredcreampiebig titssukesuke-074suke074428suke-074
    • 2021-06-12
    134 min

    [XRL-010]Perversion Training H

  • momose asuka censoredsingle workXRLreal worksreal real worksXRL-010XRL010xrl00010
    • 2021-06-16
    150 min

    [MVSD-467]School Uniform Sex At The End Of The Summer Slow Raw Sex Threesome With Step Cousin And Step Uncle Mei Satsuki

  • satsuki mei censoredcreampieschoolgirlMVSDm s video groupMVSD-467MVSD467mvsd00467
    • 2021-06-19
    180 min

    [JUL-611]No: A Beautiful Woman With Thorns Yes: A Married Woman With Gaps - Sakuraka Mizuki 28 Years Old AV Debut!!

  • sakuraka mizuki censoredmarried womanmature womanJULmadonnakannana dynanaJUL-611JUL611jul00611
    • 2021-06-26
    186 min

    [JKSR-497]Will You Have A D***k With Me Ma'am？ We Tried Getting A Married Woman To Swallow Liquor - And Cum. @ Shinjuku - Rural Wives Only - Picking Up Married Girls At A Bus Stop With Reasons To Cheat 12

  • censoredamateurJKSRbig morkalprink junkyJKSR-497JKSR49757jksr00497
    • 2021-07-18
    106 min

    300MAAN-675 [Big Breasts H Milk X Explosive Tide Splash X Explosive Iki Convulsions Sex 5th Round] Intense Volumey H Cup Milk Is Horny Erotic In Rabbits! Miss Dirty Little Esthetics! Do You Put Out This Much？ ？？ Super Large Amount Of Splash With Cont

  • amateur censoredcreampiebig titsmaanmaan-675maan675300maan-675
    • 2021-07-31
    57 min

    HEYZO 2577 Orgasms With A Horny Pussy Girl Vol.20 – Nana Kamiyama

  • nana kamiyama uncensoredcreampieheyzo
    • 2021-08-15
    57 min

    230OREC-866 Rio (Provisional)

  • amateur censoredcreampiemarried womanorecorec-866orec866230orec-866
    • 2021-08-20
    119 min

    [DASD-905]The Summer When I Connected Deeply With My Uncle, Starring Alice Nanase

  • alice nanase censoredcreampiebeautiful girlDASDdasmishima rokusaburoDASD-905DASD905dasd00905
    • 2021-09-11
    52 min

    C0930 ki210911 Reiko Tokuda 58years old

  • amateur uncensoredc0930
    • 2021-09-24
    117 min

    [ROE-010]My Stepmom Aspires To Be An Underwear Model, And She Lured Me To Temptation With Her Alluring Body ... So For A Week, I Descended Into The Pleasures Of Fucking, Simply Obeying My Basic Instinct ... Momoko Isshiki

  • momoko isshiki censoredbig titsmature womanROEmadonnashouten shiroumonroeROE-010ROE010roe00010
    • 2021-09-29
    59 min

    494SIKA-112 Gully Small Tits J ○ And 3P Sex

  • amateur censoredamateurbukkakesikasika-112sika112494sika-112



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies