hours more creampie censored young wife jav




FC2CJODFSDSSMILKSQTEAMBIHZGDCESDGMEMMIAAHDKAMIDVMEYDPREDVENXKBIDASDROYDPPPDCHRVAWD

2020-12-09
50 min

[opcyn-126]すず(22)

  • amateur censoredcreampieamateuropcynopcyn-126opcyn126opcyn-126
    • 2020-12-11
    59 min

    FC2PPV 1590525 [Personal shooting] Appearance / Chino 20 years old / After making a mysterious beautiful girl lick a lot of whole body & make a big cock blowjob, I have made a raw fuck and vaginal cum shot to a beautiful man!

  • amateur uncensoredfc2
    • 2020-12-18
    42 min

    FC2PPV 1609949 ■ Limited to 24 hours ■ Be careful of danger because you are too young. 18 year old nursing student. [Super bristle translation ant beautiful girl] Almost a virgin is first time. A miracle reappears while saying that the popular Anoko

  • amateur uncensoredfc2
    • 2021-01-01
    105 min

    [JRW-024]This Really Happened: Naked Hotels 19 - I Thought The Reviews For This Inn Looked Way Too High, So I Decided To Try Out The "Exceptional Services For Male Guests" For Myself - Erotic Hot Spring Hotels

  • ayukawa rui miyoshi nagi censoredbig titsmature womanJRWrubysuke kato 6JRW-024JRW024jrw00024
    • 2021-01-10
    133 min

    [KYMI-010]High-Class Slut With Big Tits Pleasures Guys Fully Clothed In A Hotel Suite - H-Cup In A High-Legged Leotard Yuri Honma

  • really censoredbig titsslutKYMImiluaida yumenoKYMI-010KYMI010kymi00010
    • 2021-01-10
    74 min

    300NTK-499 [Inviting Nasty Wife] A perverted woman in a coat with erotic underwear on the finest dirty BODY! ？？ Inside the brain miso is a idiot that occupies SEX & Ji ○ Ko! ？？ Body and tech are super-class Echiechi technique Impulsive cheating s

  • amateur censoredcreampiemarried womanntkntk-499ntk499300ntk-499
    • 2021-01-12
    236 min

    [MQSM-001]Hot And Horny Human Doll: The Legendary Orgasm Files - Female Body Being Made To Cum Relentlessly Under The Blazing Sun

  • censoredbeautiful girlMQSMmercuryecstasy ismMQSM-001MQSM001h-1133mqsm00001
    • 2021-01-16
    45 min

    H4610 ori1745 Mina Asao 20years old

  • amateur uncensoredh4610
    • 2021-02-05
    53 min

    FC2PPV 1673806 [Big breasts sister] Orgy out in a house! Hcup Boyne milk hanging and straddling a man Porcio convulsions big cum ♥ Raw Saddle personal shooting party until morning [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-12
    145 min

    [IPX-607]Hey, Hey, You Wanna Fuck？ Sucking School Life With A Super Cute Beautiful Y********l In Uniform Amu Amatsuka

  • amatsuka amu censoredsquirtingschoolgirlIPXidea pocketdishIPX-607IPX607ipx00607
    • 2021-03-08
    72 min

    FC2PPV 1716836 [No] [Complete appearance] 20-year-old Faculty of Literature Neat and clean beautiful girl Yuki-chan ＃ 2 Geki Iki cum shot begging sex of a naive girl who woke up to sex First toys & anal licking & standing back & cleaning [*

  • amateur uncensoredfc2
    • 2021-03-13
    236 min

    [CEAD-333]Now That I've Thought About It, I Want To Watch! Grinding, Pressurizing Cowgirl Sex, As This Beautiful Woman Pounds Her Pussy Against Your Cock As She Mounts You And Shakes Her Ass With Abandon!

  • mao watanabe yui hatano censoredcreampiemature womanCEADceleb no tomoCEAD-333CEAD333cead00333
    • 2021-03-14
    31 min

    275OCHA-083 Hikaru

  • amateur censoredcreampieuniformochaocha-083ocha083275ocha-083
    • 2021-03-25
    45 min

    FC2PPV 1741123 Celica and amateur’s 5P Celica’s cuteness and the tension of shooting make it impossible to shoot … Then the eagle is vaginal cum shot at the end

  • amateur uncensoredfc2
    • 2021-03-26
    57 min

    510ELLO-004 [Rapid rise] There is a report of obedient Sase junior.

  • amateur censoredamateurbeautiful girlelloello-004ello004510ello-004
    • 2021-03-29
    53 min

    492JCHA-044 Destroy JK with the first denma 3

  • amateur censoreduniformschoolgirljchajcha-044jcha044492jcha-044
    • 2021-03-30
    44 min

    292MY-444 Kotono Sawakita 2

  • amateur censoredbig titsmarried womanmymy-444my444292my-444
    • 2021-04-03
    169 min

    [ZMEN-082]Amateur Cosplayer Gets D**gged, R**es, and Cums! 12

  • narita tsumugi hinako mori censoredcosplayZMENz mennaveZMEN-082ZMEN082zmen00082
    • 2021-04-09
    119 min

    [EBOD-818]Starring The Best Nipples In E-BODY History! From K-Cups To P-Cups - Sandwiched Between Huge Tits In A Three-Some Harem Yua Asakura Iori Yuki

  • yu asakura yuuki yuuki censoredcreampieEBODe bodynao masakiEBOD-818EBOD818ebod00818
    • 2021-04-14
    126 min

    [GVH-220]First Time Anal Beautiful Sluts Get Their Asses Fucked For The First Time Yurika Aoi

  • yurika censoredanalcreampieGVHglory questtorindoru tanakaGVH-220GVH22013gvh00220
    • 2021-04-18
    68 min

    FC2PPV 1775865 [T ● Many appearances] An older sister from the Race Queen unit. Cum 10 barrage

  • amateur uncensoredfc2
    • 2021-04-24
    81 min

    200GANA-2473 Seriously Nampa, first shot. 1625 Bring a neat and clean woman waiting for her dad to the hotel and take a photo! The photo session is getting harder and harder … I was mature until a while ago, but when it comes to SEX, I panting!

  • amateur censoredbig titsamateurganagana-2473gana2473200gana-2473
    • 2021-05-22
    91 min

    [XRL-007]I Love Cock! Cock Sucking Slut Riko Shinohara

  • riko shinohara censoredcreampieblowjobXRLreal worksreal real worksXRL-007XRL007xrl00007
    • 2021-06-04
    66 min

    230OREC-784 N-chan

  • amateur censoredcreampieuniformorecorec-784orec784230orec-784
    • 2021-06-10
    133 min

    [IENF-146]Picking Up Real Amateur Wives - Would You Help Wash A Male Virgin's Stuck Foreskin？ It's Been Ages Since She's Seen A Hard Cock, So She's Ecstatic To Break Him In!

  • aichi michiru yamamoto renka censoredcreampiebig titsIENFienergytiger kosakaiienfIENF-146IENF1461ienf00146
    • 2021-06-20
    124 min

    [OPKT-030]Forbidden Pregnancy OK: Creampie Part-time Job - Sara Tsujimiya

  • tsujimiya sara censoredcreampieslutOPKTtoyohikotoyohikotoyohiko kikakuOPKT-030OPKT030opkt00030
    • 2021-07-01
    61 min

    324SRTD-0235 Dirty Mom Who Wants Saffle Sperm Even Though She Has Just Born

  • amateur censoredcreampiebig titssrtdsrtd-0235srtd0235324srtd-0235
    • 2021-07-05
    81 min

    493NAEN-065 [Outflow] Ginza hostess pillow business! Rio Sakagami who violently commits the highest sensitivity Ginza Mako

  • amateur censoredamateurbeautiful girlnaennaen-065naen065493naen-065
    • 2021-07-09
    110 min

    300NTK-601 Drunk 4P! !! The W cowgirl where the slender beauty body of a new graduate OL who is too beautiful dances warped is a masterpiece! !! With the finest technique that does not seem to be a newcomer, insert the Gachibokki boss Ji ○ into the o

  • amateur censoredcreampieamateurntkntk-601ntk601300ntk-601
    • 2021-07-11
    115 min

    [083PPP-2183]人気女優・きみと歩実を泥酔させたら引くぐらいエロいSEXが撮れちゃいました

  • amateur censoredbig titsamateurpppppp-2183ppp2183083ppp-2183
    • 2021-07-19
    76 min

    FC2PPV 1930903 [9980 → First Time Limited 2980] First Shot ❤️ Cute Child Who Came To Tokyo At The Time Of Admission ❤️ Complete Appearance Of A Miracle By Squeezing The Power Of Adults ❤️ Cum Shot With The Second Cock In Life ❤️ Naka Is Useless ̷

  • amateur uncensoredfc2
    • 2021-07-30
    32 min

    359TYVM-178 Too Much Masturbation! ？？ A Fifty Wife Who Shyly Says That Her Clitoris Is Big. Her Son Leaves The Nest And Has Time To Immerse Himself In Masturbation, But She Is 53 Years Old Who Is Not Enough And Dabbles In Another Stick.

  • amateur censoredcreampiemarried womantyvmtyvm-178tyvm178359tyvm-178
    • 2021-08-06
    149 min

    [HODV-21596]I Filmed An AV! A Convenient Devilish Little Slut With G-cup Breasts - Yuka Hoshi

  • yuka hoshi censoredcreampiebig titsHODVh m pHODV-21596HODV215965642hodv21596
    • 2021-08-31
    49 min

    C0930 ki210831 Mari Tadokoro 50years old

  • amateur uncensoredc0930
    • 2021-09-10
    116 min

    [DASD-916]Gorgeous Stepmom And Step-daughter. Stepmom Meets Up With Step-daughter After Decades Apart. Minami Hatsukawa. Tsubaki Kato

  • hatsukawa minami kato camellia kaoru natsuki censoredcreampiemature womanDASDdaschinpo dazaiDASD-916DASD916dasd00916
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-17
    160 min

    [MIDE-971]A Super Lewd Girl Speaking A Dialect Gets You Off: Prostitution Residence - Kibo Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyztorendei yamaguchimoodyz divaMIDE-971MIDE971mide00971
    • 2021-09-23
    67 min

    FC2PPV 2239032 * Limited Time Price & Bonus * [Conceived Soup 4 Consecutive Vaginal Cum Shot] Active Esthetician Wife 33 Years Old. Unequaled Demon Ji ○ Pogan Thrust Fuck And Gachi Convulsions Cum! Gonzo Outflow With A Perverted Wife Who Goes Craz

  • amateur uncensoredfc2
    • 2021-09-25
    120 min

    [KAGP-196]I Will Wash Your Cock 4: 9 Amateurs" Part-time Job

  • censoredamateurblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-196KAGP196kagp00196
    • 2021-09-25
    69 min

    FC2PPV 2247468 * Urgent Notice! Only For 2 Days ★ Nigoo Works Innocent Beautiful Girl ♥ Yuri-Chan 18 Years Old ♥ Limited Re-Release In Response To User’S Request! [High Image Quality And Benefits]

  • amateur uncensoredfc2
    • 2021-10-15
    150 min

    [BLK-524]TOKYO Gal Sexual Services Center, Miyu Oka

  • miyu sakuraka censoredslutsingle workBLKkira kirakira hosi kira black galBLK-524BLK524blk00524
    • 2021-11-11
    97 min

    DCH-017 Sari (Sara Uruki)

  • amateur censoredamateurbeautiful girldchdch-017dch017dch-017
    • 2021-11-13
    123 min

    [ZOCM-012]In The Reiwa Era, Only The Gal Babes Will Win. Enjoy Nipple Licking And Cozy Whispering Temptation To Blow Your Mind With Shivering Pleasure! Time-Saving Quickie Sex With An Excessively Brilliant Slut Gal Himawari Himawari Nagisa

  • sunflower censoredcreampieuniformZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-012ZOCM012zocm00012
    • 2021-11-13
    240 min

    [TIKB-126]A Sex Friend with Huge Tits and Super Sexy Body Released!

  • censoredcreampiebig titsTIKBchikichikiba gu mousozokuTIKB-126TIKB126tikb00126
    • 2021-11-25
    240 min

    [NHDTB-605]A Collection Of Selected Outdoor Sex Scenes Where A Woman Who Resists Is Ignored And Thrusts Her Way To Climax.

  • censoredNHDTBnatural highNHDTB-605NHDTB6051nhdtb00605
    • 2021-12-12
    107 min

    390JNT-031 [Saddle Tide Queen] Matching With A Beautiful And Super-Style Judicial Scrivener! !! We Devour The Best Body That Has The Best Beautiful Breasts And Peach Butt That Is Comfortable To Massage In The Thinly Cracked Abdominal Muscle Body! !!

  • amateur censoredcreampiesquirtingjntjnt-031jnt031390jnt-031
    • 2022-01-07
    62 min

    498DDH-060 A Gal Who Wants To Be Faithful To His Desire To Call Himself [Hobby: Nipple Groping]! Aiming At Ji ● Po And Rushing Forward "Don’t Be Afraid W" Sperm Cum Swallowing Happily And Deliciously → Mitsubayashi Ma ● When You Divide I

  • amateur censoredamateurddhddh-060ddh060498ddh-060
    • 2022-01-08
    65 min

    [CSDX-020][4K] Cosplay x Natsu Tojo

  • natsu tojo censoredcreampiesquirtingCSDXcosdeluxCSDX-020CSDX020h-1558csdx00020



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies