high vision nampa amateur jav housewife




FC2ROYDNACXCJODKBIJUFEBLKKSBJAPODPREDCESDBBANCAWDMVSDAWDGVHMIDVSQTESHKDCHRVABW

2020-11-19
121 min

[OKSN-308]New Wives With Godly Tits: A Cherry Boy Finds Himself In The Crosshairs Of His Dad's New Wife, Who Is A Totally Wild Slut, And Is Excited By The Potential In Her New Son-In-Law's Cock

  • censoredbig titsslutOKSNabc mousouzokuokasan.comOKSN-308OKSN308oksn00308
    • 2020-11-19
    98 min

    [MYBA-028]A Married Woman's Blooming - Aki Maisaki

  • mai sakiri censoredmarried womanmature womanMYBAmarried women s relief society emanuelyellow leopardMYBA-028MYBA028myba00028
    • 2020-11-19
    136 min

    [KTKC-099]This Dirty Old Nampa Pickup Artist Loves Big Tits And Got The Biggest Hard On Of His Life When He Met These Amateur Girls Mio-chan Yukinari [email protected] Real Name

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-099KTKC099ktkc00099
    • 2020-12-03
    487 min

    [ABBA-499]2020 Center Village Awards - MILFs In Their Fifties And Sixties Only - 30 Mature Girls, 8 Hours, 2 Discs

  • censoredcreampiemarried womanABBAcenter villageABBA-499ABBA499h-086abba00499
    • 2020-12-04
    119 min

    [ONEZ-265]Totally Divine POV Sex Any Girl At This Reflexology Salon Will Lie Down To Sleep With You While Wearing Her Uniform Mitsuha Higuchi

  • mitsuha higuchi censoredcreampieuniformONEZprestigetodoonezONEZ-265ONEZ265118onez00265
    • 2020-12-27
    54 min

    C0930 ki201231 Kazue Ichihashi 54years old

  • amateur uncensoredc0930
    • 2020-12-27

    C0930 ki201230 Self Shot

  • amateur uncensoredc0930
    • 2021-01-01
    138 min

    [FLAV-259]HYPER FETISH A Naughty Queen In A High-Cut Outfit Alice Otsu

  • otsu alice censoredsquirtingsingle workFLAVdigital arkdigital ark digital arkFLAV-259FLAV259flav00259
    • 2021-01-15
    157 min

    [MBMP-001]Picking Up MILFs! She's A Little Tipsy After A Wine Tasting, But She's Game, "Are You Sure You Want To Fuck A Cougar Like Me？" She's Delighted For The The Offer Of Raw Sex, "Oh I Can Still Get Pregnant," But Sh

  • censoredcreampiemarried womanMBMPprestigembmMBMP-001MBMP001118mbmp00001
    • 2021-01-29
    50 min

    [MASE-012]High-Rise Housewife Nanami Ravished By A Home Invader Dressed As A Delivery Guy! Pleading For Her Life, This Married Woman Is Made To Pleasure Him!

  • censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-012MASE01249mase00012
    • 2021-02-05
    189 min

    [WPS-003]WATER POLE - Michi - Himari Kinoshita: A Trendy Actress Exposes Everything And Tempts You With The Ultimate Eroticism!

  • himari kinoshita himari hanazawa censoredcosplaysingle workWPSrubyrintaro iseilluminatiWPS-003WPS003118wps00003
    • 2021-02-11
    60 min

    336KNB-141 A frustrated wife who has too little sexual activity at night plays an AV appearance! Raise a sloppy voice to the penis that you taste after a long time, expose a plump dirty body, and if you attack the back of the vagina, you will go craz

  • amateur censoredcreampiemarried womanknbknb-141knb141336knb-141
    • 2021-02-12
    270 min

    [DNW-110]No More Daddy Issues! [Tricking An Insolent Daughter To Eat Her Pussy] 04

  • censoredcreampiebig titsDNWprestigedocumentDNW-110DNW110118dnw00110
    • 2021-02-18
    58 min

    C0930 ki210218 Michiko Hirano 35years old

  • amateur uncensoredc0930
    • 2021-02-25
    106 min

    [SPRD-1382]I Creampied My Boss's Mom - Yurie Miyata

  • yurie miyata censoredmature womanmomSPRDtakara eizokyuta tukumoaleddinSPRD-1382SPRD138218sprd01382
    • 2021-02-25
    63 min

    [orec-702]ねね

  • amateur censoredcreampiebig titsorecorec-702orec702orec-702
    • 2021-03-05
    37 min

    [BTH-124]If You Cum On My Face My Husband Will Find Out...Please Try To Get It In My Mouth Miku Aoki

  • misaki aoki censoredmarried womanbukkakeBTHchobitchchovicBTH-124BTH124h-1435bth00124
    • 2021-03-07
    136 min

    [MKON-047]I Was Tutoring This Gal When She Got Unusually Touchy And Feely With Me, And I Ended Up Falling For Her, But, Just As I Suspected, I Figured Out That She Was Just A Horny Bitch Who Would Fuck Anybody Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiesingle workMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-047MKON047mkon00047
    • 2021-03-22
    201 min

    [KATU-080]Getting Jerked Off By Beautiful Smooth Thighs 5 Sluts In Miniskirts With Plump Bodies!

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-080KATU080katu00080
    • 2021-03-27
    60 min

    FC2PPV 1743137 * Weekend limited 3980⇒2980pt ★ First shot amateur ☆ Connected with a dangerous baby-faced mini girl! Erina-chan ☆ Erotic beautiful girl who is released from the tension and immersed in the pleasure of vaginal cum shot ♥ [Personal shoo

  • amateur uncensoredfc2
    • 2021-04-06
    483 min

    [KTRA-291]Step Sister Love Sex With My Smooth Hairless Step Sister 10 Girls 8 Hours 2 Video Set

  • shinozaki mio shirasaki rei censoredsisterKTRAk tribeKTRA-291KTRA291h-094ktra00291
    • 2021-04-20
    91 min

    [SDMF-019]I'm A Dirty Old Man Who Lives Like A Little Boy. And I Use My Stepmom To Satisfy My Sexual Urges. It's Just Us 2 In This 2-Room Apartment A Peachy Pair VOL.21 Rieko Hiraoka

  • rieko hiraoka censoredmature womanmomSDMFsod createeasy matsumotopeach familySDMF-019SDMF0191sdmf00019
    • 2021-04-24
    126 min

    [SQTE-368]A Sensitive Lady Gets Wet When She Is Eaten Out - Nono Yuki

  • yuki s censoredcreampieblowjobSQTEs cuteSQTE-368SQTE368sqte00368
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    50 min

    210AKO-424 MIKAKO

  • amateur censoredanaluniformakoako-424ako424210ako-424
    • 2021-05-10
    61 min

    Caribbeancom 051021-001 Very First Anal Sex With Anger Reika Kudo

  • reika kudo uncensoredanalcreampiecaribbeancom
    • 2021-05-15
    161 min

    [MMKZ-096]Girl With A Cute Face And A Huge Ass! Sari Kosaka

  • rin kosaka censoredbig titssingle workMMKZmarrionkojiro miyamotoirisMMKZ-096MMKZ096mmkz00096
    • 2021-05-15
    50 min

    Pacopacomama 051521_477 Mature Lady Piledriver Position BJ : Sakura Kazuki

  • amateur uncensoredpacopacomama
    • 2021-06-15
    135 min

    [BNST-030]Damn! A Nipple Pervert and Little Devil in a Uniform Who Grabs Nipples. Hana Shiramomo.

  • white peach censoreduniformbeautiful girlBNSTthere is alsoteacher mousouzokuBNST-030BNST030bnst00030
    • 2021-06-19
    155 min

    [JUL-613]She Looks Delicate But She Loves It Rough. Teeny Tiny Wife Rika Aohitsugi, Age 28, Makes Her Porn Debut

  • ao coffin censoredmature womansingle workJULmadonnamametaro mamezawaJUL-613JUL613jul00613
    • 2021-06-23
    116 min

    [MSA-017](Amateur) (Creampie Raw Footage) 17 Tsubasa-Chan, A Beautiful Shaved Pussy Loli With Pink Nipples, On Top Of That She Has A Cute Anime Voice (21) Moe Voice Sex While Wearing A School Uniform Cum Inside Her, Her Shaved Pussy Gets Covered In C

  • amateur censoredcreampieuniformMSAfutureMSA-017MSA017
    • 2021-07-13
    140 min

    [STARS-416]Flexible Ballerina Fucked With Huge Dick - 3 films. Anna [High-quality 4K images!]

  • anna censoredbeautiful girlsingle workSTARSsod createsuisei akaisod starSTARS-416STARS4161stars00416
    • 2021-07-30
    104 min

    [YST-252]An Amateur Photographer Tries to Imitate Ore-Chin Ends Up Unexpectedly Fucking his Model (Ha!).

  • aimi mao tajima censoredblowjobYSTkoyachoYST-252YST252540yst00252
    • 2021-08-09
    63 min

    SIRO-4601 [First Shot] [First Experience G Milk Fucking] [Indecent Eyes] A Nutritionist Who Has Both Cuteness And A Lewd Atmosphere. If You Get A Concentrated Attack On The Fruitful Breasts And Stir The Thickened Secret Part .. AV Application On The

  • amateur censoredbig titssquirtingsirosiro-4601siro4601siro-4601
    • 2021-08-12
    240 min

    [SW-791]"Put A Huge Cock In Me With My BF By My Side!" Unable To Fuck Her Hospitalized BF, These Girls Seduce A Patient In The Same Room With A Panty Shot And Take Their Erect Cocks From Across The Curtain, 15 Girls 240 Minutes Special!!

  • censoredblowjobSWswitchyocchanswitch switchSW-791SW7911sw00791
    • 2021-08-14
    130 min

    [BBTU-018]Big Boobs Training Class In A Secret Room Yukino Nagisa

  • yukino nagi censoredbig titsschoolgirlBBTUdogmatenunore no boinBBTU-018BBTU018bbtu00018
    • 2021-08-28
    240 min

    [JKSR-507]We"ll Film POV Videos Of Local Amateur Housewives 22 Loose Wives From The Kansai Region 4 Hours

  • censoredcreampiemarried womanJKSRbig mocalobockeypink junkieJKSR-507JKSR50757jksr00507
    • 2021-09-06
    53 min

    292MY-496 Uehon Nozomi 2

  • amateur censoredcreampiemarried womanmymy-496my496292my-496
    • 2021-09-17
    120 min

    [PRED-339]"Even If We Commit Infidelity, No One Will Ever Find Out, Right ...？" I Was Posted To This City, Away From My Family, And To My Surprise, I Discovered That My Neighbor Was A Colleague From Work. Minami Hatsukawa

  • hatsukawa minami censoredcreampieslutPREDpremiumtorendei yamaguchielegancePRED-339PRED339pred00339
    • 2021-10-02
    174 min

    [SORA-338]Dirty Aphrodisiac, Exhibitionist Sex with You - Hinako Mori

  • hinako mori censoredsingle workSORAyama to sorahimurokkuSORA-338SORA338sora00338
    • 2021-10-22
    61 min

    230OREC-902 Iori-San (Iori Nanase)

  • amateur censoredcreampieamateurorecorec-902orec902230orec-902
    • 2021-10-25
    34 min

    FC2PPV 2372099 Prefectural Girls’ School ② F Cup Erotic Daughter. Knowing The Value Of Your Body High ○ Debut * Limited To 100

  • amateur uncensoredfc2
    • 2021-10-25
    44 min

    FC2PPV 2369256 Appearance! !! Limited Number! [Uncensored] A Holiday Date With A Kindergarten Teacher Who Has A Strong Libido To Seduce With A Sweet Voice! Outdoor Obscenity On A Boat In The Park … Creampie In A Nasty Body That Feels The Climax

  • amateur uncensoredfc2
    • 2021-11-06
    82 min

    300NTK-650 [A Miracle Combination Of A Beautiful Girl With A Half-Hearted Ass And A Tall God Boyne! !! ] [Last This Year! ？？ The Opening Of The Summer Festival BBQ Gangbang! ？？ ] [A Wonderful Young Nympho Competition Student Naka Sex! !! ] The Best S

  • amateur censoredcreampiesquirtingntkntk-650ntk650300ntk-650
    • 2021-11-11
    135 min

    [STARS-467]性欲大解放セックスで神乳Hカップを振りまわしながら腰グイ絶頂。「本当の快感を知りました。」月乃ひな

  • tsukino hina censoredSTARSsod createinoue japansod starSTARS-467STARS467
    • 2021-11-14
    41 min

    248HDG-655 Applicant Wife Saddle Interview Anna

  • amateur censoredmarried womanamateurhdghdg-655hdg655248hdg-655
    • 2022-01-15
    102 min

    [MGMP-059]Masochistic Rubber Gloves Fetish - An Office Where A Slutty Cleaner Milks You Of Your Semen With Her Rubber Gloves

  • is it sato momoka kato sarina momonaga censoredsluthandjobMGMPmegamibijo shin premiumMGMP-059MGMP059mgmp00059
    • 2022-01-22
    248 min

    [KSAT-054]Nasty Aunt Masturbating Everywhere

  • censoredmature womanKSATstrong woman s table daydream tribetable of a strong womanKSAT-054KSAT054ksat00054



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies