high vision javcensored jav planning infidelity




FC2KSBJVENXATIDFSDSSAWDMILKCAWDNGODONEZNACXMARASPRDPPPDSSNIHMNPREDNATRMIDVSHKDWAAA

2020-10-30
56 min

FC2PPV 1551588 [Mo-no uniform] Yuuri aspiring to be a female announcer 2nd edition Attack the best beauty of 2020 with a toy! Please see her crazy … [Personal shooting]

  • amateur uncensoredfc2
    • 2020-11-11
    53 min

    FC2PPV 1566130 [Complete amateur 93] Marin 20 years old Part 4, complete appearance, vaginal cum shot 2 barrage, F cup beautiful girl’s foolery is observed perfectly on 2 screens

  • amateur uncensoredfc2
    • 2020-11-14
    60 min

    1Pondo 111420_001 Sweet kiss and Fucking: Chisato Shirataka

  • amateur uncensored1pondo
    • 2020-11-19
    120 min

    [OKSN-309]Adulterous Pleasure - She Might Be A Married Woman Now, But She's Still A Slut At Heart - Former Cum Dumpster Bumps Into An Old Flame For Passionate Creampie Sex

  • censoredOKSNabc mousouzokuokasan.comOKSN-309OKSN309oksn00309
    • 2020-11-23
    131 min

    [CEAD-324]I'm Addicted To Pleasure - Wild Masturbation Slut 9 Nene Tanaka

  • nene tanaka censoredbig titsmature womanCEADceleb no tomoCEAD-324CEAD324cead00324
    • 2020-12-06
    110 min

    428SUKE-051 [Pissing Neck Strangling F Cup Beauty] Borrowing a mobile battery and a beautiful receptionist after work and Pakopako SP! !! An erotic woman who wants to get picked up in Ginza! Slender and excellent sensitivity ♪ If you blame it with an

  • amateur censoredbig titsamateursukesuke-051suke051428suke-051
    • 2020-12-15
    40 min

    H4610 ki201215 Mai Akazaki 19years old

  • amateur uncensoredh4610
    • 2021-01-14
    117 min

    [MOND-208]My Sexy Sister-In-Law Kasumi Ikeya

  • kazumi ikeya censoredmature womansingle workMONDtakara eizohotate ikkandaiichi housouMOND-208MOND20818mond00208
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-02-06
    121 min

    [SSNI-983]This Fresh Face Manager Will Usually Manage The Team With A Smile On Her Face, But The Truth Is She Cannot Physically Handle Being Around The Big Dick Team Members, But After The Game, They Were Pumped Up And Full Of Adrenaline, And So... L

  • kodama rena censoredsquirtingsingle workSSNIs1 no 1 stylesuisei akaiSSNI-983SSNI983ssni00983
    • 2021-02-11
    131 min

    [SPRD-1377]My Brother's Wife - Her Body And Mind Call Out To Be Loved - Touko Namiki

  • namiki touko censoredmature womansingle workSPRDtakara eizohotate ikkanaleddinSPRD-1377SPRD137718sprd01377
    • 2021-02-20
    240 min

    [YSAD-048]I'm About To Defile This Girl's Oral Orifice

  • airi mashiro shitara arisa censoredcreampieYSADlight night butterflyYSAD-048YSAD048540ysad00048
    • 2021-02-20
    50 min

    1Pondo 022021_001 Meet and SEX in XX seconds: Miku Aoyama

  • amateur uncensored1pondo
    • 2021-02-26
    26 min

    FC2PPV 1702991 [Limited time] LJK that squirting does not stop even during insertion. The sea is created by squirting. * Personal shooting

  • amateur uncensoredfc2
    • 2021-03-07
    119 min

    [HKD-133]Captivated By A Younger Guy's Body - Miyuki Tsubasa

  • miyuki tsubasa censoredmature womansingle workHKDrubysuke kato 6mama rubyHKD-133HKD133hkd00133
    • 2021-03-21
    145 min

    [HND-959]Number One Serious And Shy Porn Star Gets Cummed Inside Of For The First Time Nanase Asahina

  • asahina nanase censoredcreampieblowjobHNDhon nakamametaro mamezawaHND-959HND959hnd00959
    • 2021-03-31
    59 min

    FC2PPV 1748356 A fashionable girl with green hair appears, a shy person, but a lot of disorder of personality sudden change, "Personal shooting" individual shooting original 115th person, raw squirrel

  • amateur uncensoredfc2
    • 2021-04-09
    129 min

    [MUDR-145]School Uniform Class Reunion Cuckholding HHܘX

  • ai kawana censoredcreampieuniformMUDRmukuMUDR-145MUDR145mudr00145
    • 2021-04-10
    43 min

    C0930 hitozuma1352 Kaho Kagaya 26years old

  • amateur uncensoredc0930
    • 2021-04-17
    50 min

    FC2PPV 1774144 I tried Gonzo an idol class girl

  • amateur uncensoredfc2
    • 2021-05-02
    71 min

    413INST-118 Happy Meri Chri Orgy Video With Too Cute Gal Santa [OL Nampa Heaven]! Seeding pie bread

  • amateur censoredcreampieamateurinstinst-118inst118413inst-118
    • 2021-05-02
    23 min

    FC2PPV 1799148 GW limited [appearance] Prefectural general course ③ Karate club beautiful girl. Pre-graduation treasured video. Secretly vaginal cum shot

  • amateur uncensoredfc2
    • 2021-05-07
    152 min

    [DASD-858]I'm A Lowly S*****t, But I Succumbed To The Sweet Temptation Offered By Two Female Teacher Babes, And Now, After School, We're At The Love Hotel, Having Creampie Sex, Over And Over And Over Again. Waka Misono Yuria Yoshine

  • misono waka yoshine yuria censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-858DASD858dasd00858
    • 2021-05-14
    115 min

    [SSIS-067]"Ugh, That Bitch Is So Annoying, She Acts Like She's A Celebrity. Pump Her Full Of Your Cum." Betrayed By Her Own Best Friend And Ravished By Low Class Thugs Until She Cums On Camera Mako Iga

  • iga mako blue censoreddeepthroatdramaSSISs1 no 1 stylehirokoji osakiSSIS-067SSIS067ssis00067
    • 2021-05-20
    123 min

    [FSDSS-227]FIRST FALENO Shocking Transfer Release Special Minamo Nagase

  • minase nagase censoredbig titssquirtingFSDSSfalenomusetafaleno starFSDSS-227FSDSS2271fsdss00227
    • 2021-05-22
    63 min

    Caribbeancom 052221-001 The soul sucking woman wearing a sweater Akari Satsuki

  • akari satsuki uncensoredcreampiecaribbeancom
    • 2021-05-27
    42 min

    10musume 052721_01 The Structure Of Woman : Measuring Size of My Barely Legal Body Parts Keiko Miyahara

  • amateur uncensored10musume
    • 2021-05-28
    151 min

    [MIAA-445]Looking For A Dick To Suck Cum Swallowing Date With A Girl Who Loves Sucking Cock Marina Saito

  • marina saito censoredblowjobslutMIAAmoodyzeveryone s porn starMIAA-445MIAA445miaa00445
    • 2021-06-02
    78 min

    435MFC-111 [Legal Lori Beautiful Girl] Must-see for all Lori ○ N! !! An overwhelming beautiful girl with a very thin waist appears in a short stature! Serve saffle erotically with a minimum body ♪ It feels so good that the climax does not stop! While

  • amateur censoredcreampieamateurmfcmfc-111mfc111435mfc-111
    • 2021-06-04
    119 min

    [JUL-605]On The Seventh Day Of Being Ravished By My Husband's Boss, I Lost All Sense Of Reason... Ayaka Muto

  • ayaka muto censoredmature womansingle workJULmadonnatakeshi kogaJUL-605JUL605jul00605
    • 2021-06-05
    220 min

    [DSD-827]BLACK x BLACK Kings With Huge Cocks And Beautiful Black Women

  • tina trum skin diamond censoredblowjobDSDmomotaro video publishinglexington steelesweetdevilDSD-827DSD827dsd00827
    • 2021-06-06
    37 min

    233BAT-090 Asahi

  • amateur censoredbig titsamateurbatbat-090bat090233bat-090
    • 2021-06-11
    119 min

    [MIAA-455]My Cousin From The Country Is So Bored - Teasing Nipples With Her H-Cup Colossal Tits! She'll Get You Harder Than You've Ever Been In Your Life! Rui Miura

  • rui miura censoredbig titsslutMIAAmoodyzeveryone s porn starMIAA-455MIAA455miaa00455
    • 2021-06-12
    130 min

    [DPMI-059]Unreal Panty Hose Legs: Miyabi Midorikawa

  • midorikawa miyabi censoredsingle workDPMImiludopamixDPMI-059DPMI059dpmi00059
    • 2021-06-19
    147 min

    [JUL-617]She Said It Was For Work: Adultery Trip Kana Yume

  • kana yui censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-617JUL617jul00617
    • 2021-07-06
    142 min

    [SDNM-294]This Beautiful Caregiver Is Cheerful And Energetic And Spends Every Day Taking Care Of The Elderly Miyu Kurita 28 Years Old The Final Chapter Exhibitionist / Tied Up / Golden Shower Action ... She's Away On A Vacation, Far Away From Her

  • miyu kurita censoredsingle workSDNMsod createdainanahonmono hitodzuma dannani naisho de av taikenSDNM-294SDNM2941sdnm00294
    • 2021-07-06
    94 min

    261ARA-496 [Transcendence Gal] [Absolute Beauty] Hono-chan is here! The reason for her application, who works at a hair removal salon, is "I want you to see my beautiful body ♪" I applied to show off! ？？ [Enchanted slender BODY] A dynamite bo

  • amateur censoredbig titsamateuraraara-496ara496261ara-496
    • 2021-07-17
    149 min

    [HMN-022]Secretly Making Babies With My Girlfriend's Infatuated Sister, Starring Hana Himesaki

  • himesaki hana censoredcreampiebig titsHMNhon nakausa pyonHMN-022HMN022hmn00022
    • 2021-07-17
    118 min

    [CAWD-255]First Experiences At Age 18... Hard Dick Drilling! Her Pussy Awakens Her Inner Slut, And She Has Her First Ever Squirting Orgasm! First Creampie Special So Aoi

  • aoi sou censoredcreampiesquirtingCAWDkawaiitake dCAWD-255CAWD255cawd00255
    • 2021-08-06
    120 min

    [EYAN-171]美白肌の激スリム妻が夫のムキムキ巨漢上司から種付けプレスで快楽堕ち… それ見てシコる寝取られ旦那 有坂深雪

  • arisaka miyuki censoredcreampiesquirtingEYANe bodygoemonhanazakari no tsumatachiEYAN-171EYAN171eyan00171
    • 2021-08-21
    72 min

    FC2PPV 2056474 [No Individual Shooting, Beautiful Face That Can Only Be Seen Here, 〇Waves Very Similar To The Beach, Full-Scale Fetish Non-Stop 2 Consecutive Cum Swallowing That Is Too Erotic] Eimi-Chan, Who Does Not Need Explanation, Is Wearing Gym

  • amateur uncensoredfc2
    • 2021-08-29
    72 min

    FC2PPV 2101993 [Pre-Sale] Mayu-Chan, A Tall Slender Beauty, 4th Time-I Was In Heat With A Race Queen Costume And Decided To Make Two Consecutive Vaginal Cum Shots ♥

  • amateur uncensoredfc2
    • 2021-09-26
    61 min

    200GANA-2566 Seriously Nampa, First Shot. 1696 A Fashionable Beauty Who Is A Manly Man Who Got At Omotesando At Night! I Think That It Is A Strong Personality, But When I Get Drunk, The True Nature Of De M Becomes Apparent! Shake The Big Breasts And

  • amateur censoredbig titsamateurganagana-2566gana2566200gana-2566
    • 2021-09-28
    54 min

    FC2PPV 2258231 ★ Invoking Guerrilla Publication ★ 19-Year-Old I Cup Big Breasts Girl! Discovered On Sns Nan * T ★ The Yin Yang Big Breasts Woman Who Smiles Grinning At The Ochi ○ Npo Was Duero ★ With The First Super Erotic Privilege

  • amateur uncensoredfc2
    • 2021-10-29
    119 min

    [SHKD-976]4-Timing Neat And Clean Bitch Revenge Fuck Orgy Tsumugi Akesato

  • akari tsumugi censoredcreampiebeautiful girlSHKDattackersmaeda bungoushi yoru akuSHKD-976SHKD976shkd00976
    • 2021-11-12
    60 min

    230OREC-934 Uika (Noau Ika)

  • amateur censoredcreampieamateurorecorec-934orec934230orec-934
    • 2021-11-24
    143 min

    [MTALL-004]A Crazy BBQ Reserved For Married People: Get Fucked If You Get Hard Because Of Kaho Imai"s Temptation

  • kaho imai censoredcreampiebig titsMTALLmateriallMTALL-004MTALL004
    • 2021-11-25
    187 min

    [NHDTB-604]Massage Parlor Where Tiny Girls Are Tied Up And Made Cum 2

  • censoredsquirtingNHDTBnatural highrafting maeshiroNHDTB-604NHDTB6041nhdtb00604



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies