high 076




FC2ADNWAAACAWDMIAAPPPDFSDSSSQTESPRDSSNISDABWANZGVHNACRMIDENNPJCESDABWVENUGMEMDTT

2021-01-08
121 min

[FSDSS-151]HIPPOP Ass Lover, Ultimate-ism Ayaka Tomoda

  • ayaka tomoda censoredslutsingle workFSDSSfalenomusetafaleno starFSDSS-151FSDSS1511fsdss00151
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-19
    72 min

    FC2PPV 1651512 I messed up my slender innocent girl with Lady Gras until it got crazy ~ ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-23
    21 min

    H0930 ki210123 piddle 20years old

  • amateur uncensoredh0930
    • 2021-02-06
    57 min

    Pacopacomama 020621_431 Sex at front door 26 – Shapely Figure Stands Out Sexy Lingerie Sumire Maeda

  • amateur uncensoredpacopacomama
    • 2021-02-11
    58 min

    [orec-693]りな

  • amateur censoredcreampiebig titsorecorec-693orec693orec-693
    • 2021-02-11
    50 min

    [gerk-347]りほ姉ちゃん

  • amateur censoredcreampieamateurgerkgerk-347gerk347gerk-347
    • 2021-02-12
    134 min

    [KBI-053]She Commits Adultery With Her Naughty Body. A Throbbing, Instantly Cumming, Sensual Maso Body A Former Music Teacher 3 Deep And Rich Fucks!! Minaho Ariga

  • ariga minaho censoredbig titsmature womanKBIprestigesamansa tabatakanbiKBI-053KBI053118kbi00053
    • 2021-02-12
    143 min

    [HONB-205]Beach (Bitch) - POV Footage With Hot Girls - 2 Sluts Scored!

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-205HONB205h-1133honb00205
    • 2021-02-12
    126 min

    [GONE-029]I-Cup Tits: Sexy Tanned Busty Babe Over Age 30

  • censoredcreampiebig titsGONEmercuryan erotic tanned elder sisterGONE-029GONE029h-1133gone00029
    • 2021-02-19
    144 min

    [MKON-046]My Girlfriend Acts Like A Cold Fish, But I Found Her Secret Porn Account Kaede Ito

  • kaede ito censoredcreampieuniformMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-046MKON046mkon00046
    • 2021-02-26
    53 min

    FC2PPV 1702530 > Leaked neat and clean station Anna affair video The announcer of the station in Tokyo is a serious SEX (creampie) (first public release) to relieve stress at a late-night love hotel secret meeting

  • amateur uncensoredfc2
    • 2021-03-06
    47 min

    C0930 tk0029 Ruka Umaji 28years old

  • amateur uncensoredc0930
    • 2021-03-09
    129 min

    [MSFH-053]Big Titty Young Wife Who Recently Moved To The Countryside Forgot All About Her Husband Once She Learned The Pleasures Of Wet And Wild Sex With The Perverted Older Man Next Door

  • kiyo ami censoredbig titssingle workMSFHsod createryo inugamims sodMSFH-053MSFH0531msfh00053
    • 2021-03-09
    54 min

    FC2PPV 1719080 First shot ❤️ Petite and slender, but being mischievous by a de S twinte girl [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-13
    150 min

    [APKH-165]I Discovered This Quiet And Unassuming Girl In Glasses At The Library, But It Turns Out That She's A Super Big Tits Horny Bitch, And She Sucked All Of My Semen ... Nenne Ui

  • first love censoredcreampiebig titsAPKHaurora project annexhaurora project anexAPKH-165APKH165apkh00165
    • 2021-03-18
    480 min

    [HHOY-009]Your Stepmom Acts Like She Doesn't Want It, But She Gives In, In The End Highlights Collection - Stepmoms Transform Into Sluts For Their Stepsons' Dicks - And His Friends'

  • censoredmature womanHHOYoyashoku.companyhhh groupHHOY-009HHOY009hhoy00009
    • 2021-03-21
    149 min

    [CJOD-291]A Snack Bar Slut Mama With Rocket-Sized Titties Is Giving Me Creampie Nookie All The Time Hikari Sena

  • hikari sena censoredcreampiebig titsCJODchijo heavenhirokoji osakiCJOD-291CJOD291cjod00291
    • 2021-03-22
    148 min

    [APKH-168]Cute, Tiny Teen With Braided Hair Takes A Load From A Guy Older Than Her Dad! Wild POV Footage Of A Beautiful Y********l In Uniform Miruka Aoyama

  • do you see aoyama censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-168APKH168apkh00168
    • 2021-03-26
    101 min

    [GNAX-048]This Neat And Clean Young Wife Was Getting Fucked By A Homeless Man Every Day, And She Struggled To Withstand His Awful Smell While Getting Banged, But In The End ... Natsu Tojo

  • natsu tojo censoredcreampiedeepthroatGNAXnagiranagira kenzoGNAX-048GNAX048h-1345gnax00048
    • 2021-04-03
    104 min

    FC2PPV 1752327 Celebration! The 4th thank-you project for a cumulative total of over 20,000! [No individual shooting, outflow, young lady Gachi Beautiful girl NO. Who was sold by the dark route without being asked anything. 3] I’ll just say that

  • amateur uncensoredfc2
    • 2021-04-20
    240 min

    [ARM-974]Raunchy Asses Shake And Buck As They Sexily Riding Dick Cowboy Style

  • abe mikako ai mukai censoredblowjobARMaroma planningaromaARM-974ARM974arm00974
    • 2021-04-24
    126 min

    [SQTE-368]A Sensitive Lady Gets Wet When She Is Eaten Out - Nono Yuki

  • yuki s censoredcreampieblowjobSQTEs cuteSQTE-368SQTE368sqte00368
    • 2021-04-26
    55 min

    [083PPP-2128]デリヘルNo.1盗●！(56)～大物政治家も利用する下関の超有名店で本●

  • amateur censoredamateurpppppp-2128ppp2128083ppp-2128
    • 2021-05-01
    103 min

    [ADN-317]I Fucked Miss Yuka My Homeroom Teacher - The Two Days I Can Never Tell Anyone About. Iroha Natsume

  • natsume saiharu censoredsingle workdramaADNattackersnaotootona no dramaADN-317ADN317adn00317
    • 2021-05-18
    139 min

    [STARS-364]Sirently Ravished - You Can't Make A Sound... You Can't Tell A Soul While She Rides You And Whispers In Your Ear, Then Makes You Cum. Mahiro Tadai

  • mahiro yui censoredbeautiful girlslutSTARSsod createhideyuki shinboSTARS-364STARS3641stars00364
    • 2021-05-21
    34 min

    359TYVM-158 Pinch and eat the entry / exit trader! Creampie sex with a squirting wife who works at a famous department store! !!

  • amateur censoredcreampiemarried womantyvmtyvm-158tyvm158359tyvm-158
    • 2021-06-05
    110 min

    [BKD-264]Family Fun [Higashiaizu Road] Shigure Maya

  • maya shigure censoredmature womansingle workBKDrubytobijiBKD-264BKD264bkd00264
    • 2021-06-16
    190 min

    [HUNBL-049]Shut-In Brother Who Used To Monitor His Younger Step Sister Out Of A Twisted Sense Of Love Sees Her For The First Time In Years And...

  • censoredcreampieschoolgirlHUNBLhuntergeminihhh groupHUNBL-049HUNBL049hunbl00049
    • 2021-06-23
    59 min

    Caribbeancom 062321-001 Debut Vol.68 : Continuous vaginal cum shot to the first take off former gravure idol with a smile Asami Ishida

  • asami ishida uncensoredcreampiecaribbeancom
    • 2021-07-14
    81 min

    259LUXU-1436 Luxury Tv 1430 "i Want To Have Rich Sex …" A Beautiful President Who Has Over 10 Years Of Work Without A Boyfriend Appears For The First Time! !! The Warmth And Stimulation Of The Man Who Was About To Forget … Shake The

  • amateur censoredamateurluxuluxu-1436luxu1436259luxu-1436
    • 2021-07-17
    117 min

    [NNPJ-460]Ultra Rare Amateur Country Girls Cum To Tokyo File - Beautiful Girl Even Cuter Than You Imagined - Nine Free Creampie Loads With An All-Natural Beauty From Up North Sachiko

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-460NNPJ460nnpj00460
    • 2021-07-29
    61 min

    FCP-031 [Delivery Only] It Feels Better Than Insertion … Completely Subjective! Raw Ma ● Co Intercrural Sex! !! 2

  • amateur censoredbig titsamateurfcpfcp-031fcp031fcp-031
    • 2021-08-03
    65 min

    422ION-0074 Secret Meeting NTR Gonzo At A Love Hotel With My Sister-In-Law

  • amateur censoredmarried womanamateurionion-0074ion0074422ion-0074
    • 2021-08-06
    35 min

    FC2PPV 1962287 None [Limited To 100 Pieces 2980 → Off To 1480pt!] This Girl’S Blowjob Is Too Amazing! De Metamorphosis! Instead Of A Nyodo Straw, Suck Up Chuchu Gaman Juice! * Review Benefits / High Image Quality Ver

  • amateur uncensoredfc2
    • 2021-08-12
    121 min

    [FSDSS-280]I Wanted To Be A Vocalist, But One Day I Noticed My Flute Skills Were Amazing, Momo Honda

  • honda peach censoredsquirtingsingle workFSDSSfalenoboomer 44faleno starFSDSS-280FSDSS2801fsdss00280
    • 2021-08-24
    51 min

    H0930 ki210824 Takako Sanada 29years old

  • amateur uncensoredh0930
    • 2021-09-03
    160 min

    [MIAA-496]A Convenient, Plain Jane Big Tits Girl In Glasses This Young Office Lady Is An Obedient Bitch With Rock Hard Nipples, And After I Fondled Her Voluptuous Body, I Creampie Fucked Her Until The Break Of Dawn, Over And Over Again, And It"s

  • yoshine yuria nana matsumoto censoredcreampiebig titsMIAAmoodyztorendei yamaguchiminna no kikatanMIAA-496MIAA496miaa00496
    • 2021-09-03
    118 min

    [CAWD-280]Kawaii, Right？ The Most Perverted And Hard Kawaii Slut Special. Sora Hoshino

  • hoshino hoshiyoshi censoredcreampieslutCAWDkawaiitaiga kosakaiCAWD-280CAWD280cawd00280
    • 2021-09-17
    147 min

    [MIAA-502]Wife With Postpartum Depression Has Big Tits That Lactate For 15 Minutes. Sitter Gives Into Big Tit Temptation For Numerous Quick Creampie Action. Ichika Seta

  • kazuhana seta censoredcreampiebig titsMIAAmoodyzgoemonminna no kikatanMIAA-502MIAA502miaa00502
    • 2021-09-19
    127 min

    300MIUM-745 [Entertainer Class! Offensive And Defensive Strongest F Cup Body] Beautiful Style Active JD Is Rented As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts By Persuading! !! After Enjoying The

  • amateur censoredcreampiebig titsmiummium-745mium745300mium-745
    • 2021-09-24
    120 min

    [SSIS-183]During The Boss"s Absence Due To A Business Trip, I Fucked His Wife Like Crazy For Three Days. Aika Yumeno

  • yumeno aika censoredbig titssingle workSSISs1 no 1 stylemonSSIS-183SSIS183ssis00183
    • 2021-10-02
    160 min

    [LULU-099]Wife With A Big Ass Doesn"t Realize Her See-thru Slip-on Is Getting A Big Dick Hard. A Quickie Leads To Non-stop Horny Fucking And Pounding With Plenty Of Creampie Loads. Sumire Kurokawa

  • sumire kurokawa censoredcreampiesingle workLULUlunaticsruminakkusuLULU-099LULU099lulu00099
    • 2021-10-23
    53 min

    10musume 102321_01 My Sex Is Often A One-Night-Only Meeting Yuna Okamoto

  • amateur uncensored10musume
    • 2021-10-30
    135 min

    [GVH-312]Big Tits Stepmom And Step-daughter Come To Tokyo For The WNTR Exam With A Big Dick Step-cousin That Fucks Them Both Like Crazy For 3 Whole Days. Mako Oda , Kokono Terada

  • oda mako terada here censoredbig titssisterGVHglory questtakahashi chitsujiGVH-312GVH312gvh00312
    • 2021-12-04
    119 min

    [XVSR-626]Sex Filming Yui Hatano in Private!

  • yui hatano censoredcreampiebeautiful girlXVSRmax ayoshida ikuzoucalenXVSR-626XVSR626xvsr00626
    • 2021-12-06
    51 min

    230OREC-947 Miku

  • amateur censoredcreampiebig titsorecorec-947orec947230orec-947
    • 2021-12-11
    65 min

    [BAB-042]Sexy Actress Is Also A Bitch On Holidays Ichika Matsumoto

  • ichika matsumoto censoredsingle workBABbabylon mousozokuBAB-042BAB042bab00042



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies