gets 089




FC2AUKGAVSAGVHSSNIMILKMIAASPRDFSDSSJUFESQTECESDRBDHZGDWANZSANBLKMIDEAPODDASDHODV

2020-11-27
301 min

[SUPA-552]すぐヤレるS級素人スーパーBEST4 72人5時間

  • censoredcreampieamateurSUPAs kyuu shiroutok tarouSUPA-552SUPA552h-244supa00552
    • 2020-12-11
    53 min

    FC2PPV 1597311 [No] I share a daddy active girl who loves cock with two old men and make vaginal cum shot, this child is not a type that gets money from meals, but a type that earns completely with the body. 【selfie】

  • amateur uncensoredfc2
    • 2020-12-19
    59 min

    H0930 ki201220 Shigemi Sendou 44years old

  • amateur uncensoredh0930
    • 2021-01-01
    303 min

    [DKSB-096]Pretty Perky S********l Booty - Hard Dildo Masturbation BEST Collection 20 Girls, 5 Hours

  • akimoto shion niimi naomi censoredschoolgirlDKSBoffice k sk s bestDKSB-096DKSB09636dksb00096
    • 2021-01-01
    120 min

    [ONEZ-269]Obedient Sugar Baby Yukino Nagasawa vol. 002

  • yukino nagasawa censoredcreampiebig titsONEZprestigetodoonezONEZ-269ONEZ269118onez00269
    • 2021-01-16
    149 min

    [SSNI-965]No Script! POV! No Makeup! Anything Goes! Aika Yumeno 's Bare Naked, Carnal True Self - Sex Like She'd Have At Home! Ultra Rare 200 Erotic Real Couple's Hot Spring Trip Video

  • yumeno aika censoredbig titssingle workSSNIs1 no 1 styleSSNI-965SSNI965ssni00965
    • 2021-01-16
    50 min

    C0930 hitozuma1345 Sonomi Hijiri 27years old

  • amateur uncensoredc0930
    • 2021-02-01
    220 min

    [YMDD-219]Home Delivery Gal! Battle To Compare Your SK**ls And See How Much You Can Cum! Death Match: How Many Shots Can You Get Off？ vol. 02

  • ran tsukishiro yuka hoshi censoredcreampiehandjobYMDDmomotaro eizohimu lockwakamomoYMDD-219YMDD219ymdd00219
    • 2021-02-21
    142 min

    [JUL-476]This Super Sweaty Married Woman Is Powerfully Shaking Her Ass So Hard, I Ended Up Creampie Fucking Her Without Ever Moving My Hips. Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanJULmadonnasatsugu koyamaJUL-476JUL476jul00476
    • 2021-03-10
    48 min

    FC2PPV 1720869 [Former Virgin-kun x Fluffy G Lori] First Shooting, Titty Fuck, Former Virgin-kun Creampie Dreams! Breast swaying and vaginal cum shot with G fucking back as close as possible to H! The sensitivity is too high and it rolls up! Pant voi

  • amateur uncensoredfc2
    • 2021-03-11
    164 min

    [SVDVD-845]One-Way Mirror Cab Hard Boiled - S********ls We Found In The Street Squirting When They're Tied Up For Multiple Orgasms! These Amateur Girls Can't Stop Cumming For The First Time In Their Lives As They Can't Refuse Creampie Aft

  • censoredcreampiesquirtingSVDVDsadistic villagesushi yokubomagic mirror number sadistic villageSVDVD-845SVDVD8451svdvd00845
    • 2021-03-13
    180 min

    [IPX-626]Beautiful Young Slut Loves Middle-Aged Guys - Teasing, Edging Sex Tempts Her Older Lovers Anna Kami

  • anna kami censoredslutIPXidea pockettissueIPX-626IPX626ipx00626
    • 2021-03-21
    166 min

    [DASD-836]Only One Person At A Time Please High-Class Double Decker Health Club Action Renka Yamamoto Nana Asakura

  • yamamoto renka censoredbig titsDASDdashajime yanaiDASD-836DASD836dasd00836
    • 2021-03-25
    55 min

    230ORETD-858 Yukine

  • amateur censoredcreampieuniformoretdoretd-858oretd858230oretd-858
    • 2021-03-25
    80 min

    200GANA-2459 Seriously Nampa, first shot. 1613 Instinct bare sexual intercourse where a graceful busty young wife is disturbed like a beast! !! It is a must-see for the foolery that repeats the cum while blowing the tide with sex after a long absence

  • amateur censoredbig titsmarried womanganagana-2459gana2459200gana-2459
    • 2021-03-27
    139 min

    [MMUS-051]Little Devilish Provocation By A Beautiful Girl - Mahiro Ichiki

  • mahiro ichiki censoredcosplayslutMMUSmarrionkijin kasaikcpMMUS-051MMUS051mmus00051
    • 2021-04-09
    201 min

    [IPX-634]FIRST IMPRESSION 148 Best In The Reiwa Era, Beautiful Y********l With Short Hair Who Doesn't Look Like A Porn Star Kotomi Ono

  • kotoyumi ono censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-634IPX634ipx00634
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-19
    87 min

    435MFC-107 [101cm H Cup Akita Bijin JD] Local senior saffle and unsuccessful SEX ♪ While releasing the sexual desire accumulated in the pool, it is the first time in half a year to insert a vaginal cum shot and a chest shot ♪ Miyabi-chan ＃ 22 years o

  • amateur censoredcreampiebig titsmfcmfc-107mfc107435mfc-107
    • 2021-05-27
    169 min

    [MDVHJ-032]Step Mother Is Seduced By Her Husband's Son's Incredible Huge Dick Chapter 2

  • ayaka muto hotaru mori censoredbig titsmature womanMDVHJgraffiti japanmovieMDVHJ-032MDVHJ03248mdvhj00032
    • 2021-05-31
    118 min

    300MIUM-700 Get a beautiful girl without a doubt! !! A friendly apparel clerk who has been underwear in the back of her legs! I can’t stop looking at the beautiful ass! !! Super sensitive kitsuma with a jerky waist ● I was begged for a vaginal c

  • amateur censoredcreampieamateurmiummium-700mium700300mium-700
    • 2021-06-04
    77 min

    FC2PPV 1853078 [3480 → Limited number 2480] Excavation of the highest ranked 18-year-old transcendental beauty ❤️ Jie K Urgent release after graduation ❤️ Beautiful girl who works at a flower shop and dreams of opening ❤️ Inserts the second cock in h

  • amateur uncensoredfc2
    • 2021-06-11
    115 min

    [IPX-671]You Can Ejaculate One More Time, Right？ Hikari Azusa + Slut Awakening + Ultimate Continuous Orgasm

  • azusa hikari censoredbig titsslutIPXidea pocketsamoaridishIPX-671IPX671ipx00671
    • 2021-06-16
    240 min

    [DVDMS-681]Gorgeous Porn Stars Rei Kuruki And Mizuki Yayoi Break In Male Virgins While Their Families Are Home - If They Get Them Off Without Getting Caught, They Win A Prize! An Extreme Challenge With Beautiful Girls!

  • satoshi kuruki mizuki yayoi censoredcreampiesquirtingDVDMSdeep sostracismDVDMS-681DVDMS681dvdms00681
    • 2021-06-17
    118 min

    [BBTU-015]Submissive Girl With Big Tits Screams And Cums Like Crazy As She Has Her Huge Titties Covered With Cum Yuria Yoshine

  • yoshine yuria censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-015BBTU015bbtu00015
    • 2021-06-24
    124 min

    [FSDSS-246]A Studious High S*********l Seduces Guys With Her Permanent Front And Back Wedgie - Ena Satsuki

  • ena satsuki censoredschoolgirlbeautiful girlFSDSSfalenoarashiyama michirufaleno starFSDSS-246FSDSS2461fsdss00246
    • 2021-06-26
    108 min

    [XVSR-601]Babymaking Creampie Life With My Lovey-dovey New Wife - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiebeautiful girlXVSRmax aikuzo yoshidacalenXVSR-601XVSR601xvsr00601
    • 2021-06-30
    109 min

    FC2PPV 1895640 5980pt → 2980pt [Masterpiece 1 hour 48 minutes] Big tits girl who was also selected as an official recommended product is finally 3P ♥ Raw Saddle, Fucking, Release ●, Shower, Blow etc …

  • amateur uncensoredfc2
    • 2021-07-02
    59 min

    Caribbeancom 070221-001 Debut Vol.66: Big boobs girl in bikini Mao Umino

  • mao umino uncensoredcreampiecaribbeancom
    • 2021-07-06
    70 min

    H0930 ki210706 Azusa Tamai 29years old

  • amateur uncensoredh0930
    • 2021-07-09
    195 min

    [HJMO-465]Couple Challenge! After Husband Creampies Nene Tanaka twice with Her Amazing Technique, Wife is Taken and Fucked Raw in her Pussy for a Creampie SEX!

  • nene tanaka censoredcreampiebig titsHJMOhajime kikakuHJMO-465HJMO465hjmo00465
    • 2021-07-09
    165 min

    [JUFE-310]Fucking From The Male POV! Two Beautiful Seductresses Play With Him Until He Cums! Rena Aoi Narumi Hirose

  • blue narumi hirose censoredsquirtingschoolgirlJUFEfitchsamoariJUFE-310JUFE310jufe00310
    • 2021-07-11
    115 min

    [083PPP-2181]俺の家政婦ミナミさん(3)

  • amateur censoredamateurcosplaypppppp-2181ppp2181083ppp-2181
    • 2021-08-06
    63 min

    SIRO-4574 [First Shot] [Blow Job With A Horny Sound] [Amazing Continuous Iki] An Active JD With A Wonderfully Cute Shy Reaction. The Body On The Verge Of An Outburst That Has Been Overtaken By Masturbation Exposes Continuous Death Many Times .. Appli

  • amateur censoredamateursirosiro-4574siro4574siro-4574
    • 2021-08-13
    480 min

    [HHF-014]Big Tits + Swimsuits A Massive Collection Of Big Titty Babes In Swimsuits Who We Unexpectedly Find Ourselves Staring At! Guaranteed Nookie! A Furious Highlights Collection Of Sure Things

  • censoredbig titsblowjobHHFhunterhhh groupHHF-014HHF014hhf00014
    • 2021-08-20
    160 min

    [HMN-038]Snake Woman: By Possessing The Body Of A Human Female, She Licks A Lot, Mates, And Has Sex Yumi Saeki Yumika Saeki.

  • yuka saeki censoredcreampieblowjobHMNhonnakamamezawa mametarouHMN-038HMN038hmn00038
    • 2021-08-20
    235 min

    [REXD-376]Bondage In Deep Sleep! Sassy Disciplinary Chair "You Can"t Convince Me While You Look Like That"

  • censoredcreampieuniformREXDreddogroupREXD-376REXD376rexd00376
    • 2021-08-21
    193 min

    [SCPX-431]The Pushover Clerk Is Just My Type Fully Erect As We"re Alone In The Changing Room To Check My Pants "Sir...We Can"t Do This...not Here..." But She Can"t Take Her Eyes Off My Huge Cock Even Though

  • censoredcreampiebig titsSCPXk m producescoop kmpSCPX-431SCPX431scpx00431
    • 2021-09-05
    79 min

    413INST-155 [God Chippai] [Active Idol] K2 Beautiful Girl Net Idol Cheeky ♀ Bab-Chan And Personal Photo Session Gonzo Immature Pussy Creampie

  • amateur censoredcreampieschoolgirlinstinst-155inst155413inst-155
    • 2021-10-15
    150 min

    [PRED-345]A Triple Slut Office Lady Harlem Threat Horny Elder Sister Types Will Hit You With A 3-Point Combo And Make You Creampie Cum, Over And Over Again! Kano Kashii Yui Hatano Himari Kinoshita

  • kashii hanano yui hatano censoredcreampieblowjobPREDpremiumkyouseielegancePRED-345PRED345pred00345
    • 2021-10-22
    137 min

    [AKID-088]Sexually Pent-up Slutty Girls Only. In-room Peeping. Keeping Quiet For AV No. 47. Sana, G-cup, 21 Years Old, Neat And Clean, Wants To Be Taken Care Of With Money. Haruka, G-cup, 24 Years Old, Natural Airhead, Colossal Tits, Busty Hairdresse

  • censoredcreampiebeautiful girlAKIDomochikaeri mousozokumanji groupAKID-088AKID088akid00088
    • 2021-10-22
    113 min

    420POW-045 Chloe @ Reverse Bunny [Amateur Hoi Hoi Power / Gonzo / Beautiful Girl / Neat / Cosplay / Big Tits / F Cup / Famous Layer / Beautiful / Tall / Eight Heads / Highly Conscious System / Lotion Oil / 2 Shots / On The Tongue Launch] (Himari Kino

  • amateur censoredbig titsamateurpowpow-045pow045420pow-045
    • 2021-11-13
    49 min

    H4610 ki211114 Madoka Kanbe 21years old

  • amateur uncensoredh4610
    • 2021-11-18
    49 min

    FC2PPV 2444266 Healing Honwaka Bishoujo (18) With One Experienced Person, She Has A Cute Appearance With A Short Stature And A Lewd Side On The Contrary … At The End, "Put It In Me ❤️"

  • amateur uncensoredfc2
    • 2021-11-27
    51 min

    FC2PPV 2469701 [Uncensored] Bakery Signboard Girl Summary 4 Works * First Time Limited 6980 → 4980

  • amateur uncensoredfc2
    • 2021-12-02
    103 min

    [IQQQ-028]A Married Female Teacher Who Gets 10 Times Wetter Climaxing During Her Class, When She Can"t Make A Sound Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiemarried womanIQQQcenter villagesouthern earthzora center villageIQQQ-028IQQQ028h-086iqqq00028
    • 2021-12-04
    136 min

    [AVSA-186]SUPER FISHEYE FETISHISM Super Thrilling And Exciting Closeup Action Huge Titties And A Massive Ass On A Double-The-Trouble Meaty And Erotic Body

  • kanae kawahara south wind sawa censoredbig titsAVSAavsbuddha davscollectorsAVSA-186AVSA186avsa00186
    • 2021-12-04
    88 min

    [BAB-040]Japan"s Outstanding Talent. A Certain Winner of a Girl. Mizuki Amane

  • natural mizuki censoredhandjobsingle workBABbabylon daydreamersBAB-040BAB040bab00040



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies