endx




FC2HUNTBHZGDNNPJPREDJULBLKRBDBBANEBODJUFECESDSTARSCAWDHDKAFSDSSMIDEHMNWAAAPPPDHODV

2020-12-13
91 min

345SIMM-572 “It’s okay because it’s an uncle” Innocent Twinte J ○ is the first SEX & vaginal cum shot at the uncle’s house! Cowgirl practiced with naughty videos. Hajimete’s Fucking & Raw Saddle … etc. I

  • amateur censoredcreampiebig titssimmsimm-572simm572345simm-572
    • 2020-12-15
    66 min

    200GANA-2395 Seriously Nampa, first shot. 1569 Immediate sex with 1 million coins thrown to street musicians! !! !! The beautiful ass girl who came to Tokyo from Gunma forgets about her boyfriend and saffle and is enthusiastic about rich sex with an

  • amateur censoredamateurganagana-2395gana2395200gana-2395
    • 2020-12-15
    40 min

    H4610 ki201215 Mai Akazaki 19years old

  • amateur uncensoredh4610
    • 2021-01-01
    120 min

    [DNJR-041]A Gang-Banging Holy Piss-Water Lynching! I Became The Toilet For These Sch**lgirls!

  • kasagi ichika toua kotone censoredslutDNJRdog delusion groupmaboroshikoDNJR-041DNJR041dnjr00041
    • 2021-01-08
    11 min

    FC2PPV 1612266 [Personal shooting] Yayoi 23-year-old short SEX remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-01-12
    63 min

    10musume 011221_01 What if I show my unerected penis to a cute girl？ Natsumi Owada

  • amateur uncensored10musume
    • 2021-01-14
    106 min

    [ZEAA-057]Absolute Obedience Face Fuck: Married Slut Who Loves To Have Her Throat Pounded Noa Kosaka

  • kosaka censoredcreampiemature womanZEAAcenter villageamagumogoku centervillageZEAA-057ZEAA057h-086zeaa00057
    • 2021-01-19
    48 min

    FC2PPV 1650646 For a limited time [Appearance] Prefectural general course ③ Karate club beautiful girl. Dirty her uniform and pussy with sperm

  • amateur uncensoredfc2
    • 2021-01-21
    61 min

    [REBD-525]Marin 2 Basking In The Summer Sun - Marin Hinata

  • marin hinata censoredsingle workREBDrebeccazaku araiREBD-525REBD525h-346rebd00525
    • 2021-02-06
    60 min

    FC2PPV 1675350 55th individual shot, completely original, 2 vaginal cum shots, cute whip whip, pudding pudding, 2 vaginal cum shots

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    99 min

    [ZOZO-042]Miss Hikari Yuino

  • censoredcreampiebig titsZOZOsadie willenauZOZO-042ZOZO0421zozo00042
    • 2021-02-21
    121 min

    [DASD-819]In My Job-hunting Resume... When I Wrote "Small Breasts" In My List Of Advantages, I Was Called Into Another Room. Risa Shiroki

  • risa shirojo censoredbeautiful girlsingle workDASDdaskirinDASD-819DASD819dasd00819
    • 2021-03-09
    45 min

    302GERK-355 Riho (26)

  • amateur censoredcreampieamateurgerkgerk-355gerk355302gerk-355
    • 2021-03-21
    240 min

    [HNDB-188]Endless G*******g Getting Fucked By The Worst Kind Of Men Female Fall From Grace Getting Pussy Filled With Cum 112 Times

  • censoredcreampieHNDBbookHNDB-188HNDB188hndb00188
    • 2021-03-31
    300 min

    [ONNA-009]Mitsuki Nagisa Super Scandalous Film Collection

  • censoredcreampiesquirtingONNAsadie willenauONNA-009ONNA0091onna00009
    • 2021-04-04
    59 min

    HEYZO 2508 Wanna Be Fucked By Amateur Nympho MILF! Vol.4 – Kana Miura

  • kana miura uncensoredcreampiehandjobheyzo
    • 2021-04-09
    150 min

    [JUFE-276]Blowjob-Loving Slut - F-Cup College Girl Yumeka Kikukawa Getting A Science Degree Makes Her Porn Debut! She Loves The Feel Of Living Things In Her Mouth

  • yumeka kikukawa censoredbig titsblowjobJUFEfitchmichiru arashiyamaJUFE-276JUFE276jufe00276
    • 2021-04-22
    43 min

    FC2PPV 1781115 Men’s Esthetic Training Hidden Shooting (Kasumi 22 years old-2nd time) FBK for super excess service of slender beautiful breast therapist. The vaginal cum shot finish from raw insertion as it is attacked by slut play.

  • amateur uncensoredfc2
    • 2021-05-20
    130 min

    [HAVD-1008]Hot Smothering Kisses! Lesbian Sisters - They Finger Each Other's Pussies Sloppy With Spit And Love Juices And Cum Together

  • kanae lennon kagami sara censoredlesbiansisterHAVDhibinodr torihamamaniac demandoHAVD-1008HAVD10081havd01008
    • 2021-05-22
    150 min

    [DGCEMD-010]- Online Only! With Special Footage - When She Puts On Glasses She Wets Herself And Gets Horny 3 Yui Hatano

  • yui hatano censoredsquirtingmature womanDGCEMDcelebrity friendsDGCEMD-010DGCEMD010dgcemd00010
    • 2021-05-27
    95 min

    [NUKA-046]Cumming Inside Her Six Times Without Pulling Out Up Close And Personal Step Family Sex Makiko Tsurukawa

  • makiko tsurukawa censoredcreampiemarried womanNUKAcenter villageshibuyazora center villageNUKA-046NUKA046h-086nuka00046
    • 2021-06-24
    127 min

    [SW-783]"I Might Be Dumb But When It Comes To Sex I'm At The Top Of The Class! If You Do My Homework I'll Make You Feel Real Good, So Please!" Can You Believe She Said That To Me!？ Since Then She Lets Me Let Off Steam Every Day No Mat

  • censoredSWswitchlight fujimaswitch switchSW-783SW7831sw00783
    • 2021-06-24
    120 min

    [HBAD-587]A Young Wife Innocently Seduces Men With Her Big Tits And Has Secret Adulterous Sex - Saeko Hiiragi

  • hiiragi saeko censoredbig titsblowjobHBADhibinoumanami jirobabeHBAD-587HBAD5871hbad00587
    • 2021-06-26
    63 min

    10musume 062621_01 BJ In Public Restroom: I’ll lick it in the back of my throat Shizuka Sano

  • amateur uncensored10musume
    • 2021-06-27
    101 min

    413INST-134 [Personal shooting] Miraculous 18-year-old active model Photo session with an idol Raw milk, raw pussy, puzzled by comfort → Top secret personal photo session that recorded Ahegao

  • amateur censoredcreampiebig titsinstinst-134inst134413inst-134
    • 2021-07-03
    141 min

    [PKPD-154]Creampie Debut Document: Tall SSS Style Insurance Lady - Yuno Kamikari

  • yuno kamikari censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-154PKPD154pkpd00154
    • 2021-07-18
    127 min

    [BHG-039]Temptation: Estrus Sisters

  • himesaki hana maina miku censoredcreampiebig titsBHGgain corporationBHG-039BHG039bhg00039
    • 2021-07-27
    78 min

    498DDH-026 Bring A High-Grade Tall Beautiful College Student Who Can Be Mistaken For A Model To The Room! Flirtatious SEX Where You Can Enjoy The Heavy And Massive Big Breasts Of Takamine’S Flowers Who Are Tipsy And In A Good Mood! ＃ 001

  • amateur censoredcreampiebig titsddhddh-026ddh026498ddh-026
    • 2021-08-10
    480 min

    [MUCH-135]10 Girls With Top Class Bodies Getting Fucked One After The Next, Volume 3, 8 Hours, 2 Disc Set

  • miki hazuki sara saijo censoredbig titsMUCHmothermuchimuchiMUCH-135MUCH135h-796much00135
    • 2021-08-10
    151 min

    [STARS-425]Memories Of Summertime Where A Locally Famous Slutty Gal Milks So Many Cumshots Out Of Me, Hibiki Natsume

  • natsume hibiki censoredbeautiful girlsingle workSTARSsod createyazawa reshi busod starSTARS-425STARS4251stars00425
    • 2021-08-19
    54 min

    C0930 ki210819 Ayaka Hashino 34years old

  • amateur uncensoredc0930
    • 2021-08-28
    127 min

    [MCSR-447]Stop It Stepfather. Intense Stepfather That Can"t Get Enough. There"s No Place To Escape At Home!! 2 Gorgeous Wives. Reiko Kobayakawa Ka Ayano Fuji

  • kobayakawa reiko ayano kato censoredcreampiedramaMCSRbigmorkalringo star smasukattoMCSR-447MCSR44757mcsr00447
    • 2021-08-30
    102 min

    [ACZ-030]A Subservient Wife Who Swore Eternal Allegiance When She Entered Into An S&M Marriage (A Bride Who Descended Into The Pleasures Of Sex With Several Men) (The Domesticated Bitch Collector Vol.28)

  • censoredamateurbdsmACZsanwa publishingabnormal.companiesACZ-030ACZ030h-019acz00030
    • 2021-08-31
    130 min

    [SAN-018]Single Mother"s First Customer Has Firm Boobs Rin Kagura

  • kagura rin censoredbig titssingle workSANmazagod maramother mazaSAN-018SAN018h-796san00018
    • 2021-09-03
    124 min

    [MIAA-492]Gal Going Commando In A School Uniform Tries To Help Around The House But Ends Up Showing Everything, Starring Ranka

  • ranka censoredcreampieuniformMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-492MIAA492miaa00492
    • 2021-09-24
    153 min

    [DASD-914]Unlimited Cumshots. A Soapland That Offers The Ultimate Hospitality By Allowing Repeated Cumshots - Kotone Fuyuai

  • toua kotone censoredcreampiebeautiful girlDASDdastakarase hironoriDASD-914DASD914dasd00914
    • 2021-09-25
    128 min

    [CEMD-060]The Filthy Snake-Tongued Dirty Talk Counseling Bar Honoka Tsujii I"ll Solve All Of Your Perverted Problems With My Snake-Like Tongue!

  • tsujii honoka censoredbig titsmature womanCEMDserebu no tomoCEMD-060CEMD060cemd00060
    • 2021-10-07
    214 min

    [SW-803]Step-sisters" Skirts Are Too Short And Reveal Their Panties! They Show Off Their Lewd Acts And Masturbation To Their Step-brother, Making Him Lose It And Fuck Them Hard When Nobody"s Home!

  • censoredsisterSWswitchyocchanswitch hibinoSW-803SW8031sw00803
    • 2021-10-07
    135 min

    [KMHRS-055]「キスだけでびしょびしょなっちゃう…(ハート)」たぬき顔でえっちぃからだのほんわかおっとり声優の卵 AV debut 小花のん

  • kohana non censoredsoloworkKMHRSsod createarashiyama michirukimihoreKMHRS-055KMHRS055
    • 2021-10-30
    160 min

    [LULU-104]While My Father Was On A Business Trip, The Busty Mother-in-law Of Men"s Massage Parlor Girl Made Him A Practice Nude Countless Times Until His Balls Were Empty. Yuri Oshikawa

  • yuri sugawa censoredbig titsmomLULUlunaticsruminakkusuLULU-104LULU104lulu00104
    • 2021-11-01
    150 min

    [DOKS-548]A Video Dedicated To Masturbation To Beautiful Legs In Panty Stockings, Filmed By Pantyhose Lovers

  • seina rurucha censoredslutDOKSoffice k smatsumoto chrysalisDOKS-548DOKS54836doks00548
    • 2021-11-15
    82 min

    259LUXU-1501 Luxury Tv 1483 A Beautiful Italian Chef With An Attractive Exotic Atmosphere Is Now Available On Luxury TV! The Frustrated Body Is Sensitive To Stimuli! If You Witness The Long-Awaited Penis, Taste It With An Ecstatic Expression, And Acc

  • amateur censoredbig titsamateurluxuluxu-1501luxu1501259luxu-1501
    • 2021-11-19
    120 min

    [SSIS-246]The Nurse Call Button With A Titty Fuck Option - Cumshots Available Anytime! J-Cup Nurse Will Service You Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-246SSIS246ssis00246
    • 2021-11-19
    120 min

    [HMN-079]What!？ A Secret Creampie In A Place Like This!？ When A Popular AV Actress Asks Her FWB To Film Their Creampie Sex... Complicating My Private Life, We Secretly Film An AV So My Friends Won"t Find Out. Nanami Kawakami

  • kawakami nanami censoredcreampieblowjobHMNhonnakamamezawa mametarouHMN-079HMN079hmn00079
    • 2021-11-26
    44 min

    FC2PPV 2467232 [Translated Ant Special Price] [Appearance Available] [Caution For Deletion] The Translated Ant Has Been Stored, But Will Be Released. Nameless ○ Li Girl’S Creampie Sex

  • amateur uncensoredfc2
    • 2021-12-09
    120 min

    [FSDSS-332]Shame Of Commanded Public Peeing Announcer. Minamo Nagase

  • minase nagase censoredbig titssquirtingFSDSSfalenoyamaguchi memberfaleno starFSDSS-332FSDSS3321fsdss00332
    • 2022-01-01
    55 min

    200GANA-2631 Seriously Nampa, First Shot. 1737 Elegant Wedding Planners Are Actually Secretly Gathered … Mr. Mutsuri Who Gets Excited Unintentionally With The Big Cock Of An Actor! Pant Voice Of Delight To The Constant Piston! A Work That Makes

  • amateur censoredsquirtingamateurganagana-2631gana2631200gana-2631



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies