def censored over hours dmm exclusive mature woman




FC2PPPDDTTAMBIEBODHUNTBABWVEMASDABNATRSQTEMIAASSISSANPREDSHKDVENUCHRVWAAAAWDSSNI

2020-09-05
178 min

[URE-057]A Madonna Exclusive This Married Woman Was Exposed In All Her Lustful Glory By The Desires Of Young Men, And Now We're Bring It To You In Live-Action!! Based On: A MILF Shobo Publication I'm Going To Fuck My Favorite Auntie Ayumi Miu

  • ayumi miura censoredbig titsmature womanUREmadonnakitorune kawaguchiure.comiURE-057URE057ure00057
    • 2020-09-25
    49 min

    FC2PPV 1514279 [CM appearance of local station] Saddle shooting NG due to various circumstances! If it’s a pussy, I agree. However, I couldn’t stand it and got a blow job with a little extra work!

  • amateur uncensoredfc2
    • 2020-09-27
    100 min

    [SOAV-069]A Married Woman's Infidelity June Lovejoy

  • june lovejoy censoredbig titssingle workSOAVhitozuma engokai emmanuelleihyo kairoiSOAV-069SOAV069soav00069
    • 2020-09-29
    60 min

    438PVMB-009 you

  • amateur censoredamateurpvmbpvmb-009pvmb009438pvmb-009
    • 2020-10-09
    143 min

    [BAZX-251]Complete Love Declaration! Full POV Uniform Refresh vol. 001

  • ichika matsumoto himari kinoshita censoredcreampieuniformBAZXbazookatodoBAZX-251BAZX251h-1496bazx00251
    • 2020-10-18
    105 min

    [MGMQ-058]Anal With A Man In Hospital Genius Sadistic Slutty Nurse At The Masochist Sexual Clinic. With Maebi Kuru

  • coming shrimp censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-058MGMQ058mgmq00058
    • 2020-10-20
    54 min

    285ENDX-310 Yurina-san, 21 years old, a female college student who is cool with just a nipple [Amateur]

  • amateur censoredbig titsamateurendxendx-310endx310285endx-310
    • 2020-10-24
    118 min

    [JUL-353]I Was Made To Come Continuously By My Son's Friend Whom I Couldn't Resist... Maki Tomoda

  • maki tomoda censoredbig titsmature womanJULmadonnaamazing meatJUL-353JUL353jul00353
    • 2020-10-24
    64 min

    [mntj-036]ゆら

  • amateur censoredamateurmntjmntj-036mntj036mntj-036
    • 2020-10-29
    128 min

    [EUUD-033]Guerilla Visit At A Fan's Home! Why Not Try Out Kozue Tokita？ Sex With The Hottest MILF - My Creampie Sex Dream Come True!

  • kozue tokita censoredcreampiebig titsEUUDcenter villagesouthern earthjurakuEUUD-033EUUD033h-086euud00033
    • 2020-11-04
    68 min

    SIRO-4309 [First shot] [Sensitive daughter with little experience] [Healthy young skin] An active female college student who was not satisfied with her premature ejaculation boyfriend. She touched the technique of an adult and experienced the charm o

  • amateur censoredamateursirosiro-4309siro4309siro-4309
    • 2020-11-07
    150 min

    [DNJR-038]Let's Play With A Masochist Man! The Story Of A Seriously Sadistic Woman Hornily Turning A Masochist Man Into Her Toy Aoi Kururugi

  • aoi kururugi censoredbeautiful girlslutDNJRdog delusion groupmaboroshikoDNJR-038DNJR038dnjr00038
    • 2020-11-15
    68 min

    413INST-070 [4P orgy / individual shooting] Miku-chan, a 20-year-old innocent gal who becomes a spoiled boy when she feels comfortable. A large amount of horny tide is launched from a tsundere pussy that gets wet when you see a colleague who blows ne

  • amateur censoredcreampieamateurinstinst-070inst070413inst-070
    • 2020-11-20
    120 min

    [SPZ-1085]My MILF Caregiver Seduced On Camera

  • censoredamateurmature womanSPZstar paradisestar paradiesSPZ-1085SPZ1085h-254spz01085
    • 2020-12-03
    61 min

    FC2PPV 1593139 300pt OFF for a limited time [No / piece] “… I’ve come to like big ♡♡♡” My lover in my heart !？ After the first date with Nanami who is injured at a marriage party, overwriting SEX that makes me forget my ex-boyfrie

  • amateur uncensoredfc2
    • 2020-12-24
    120 min

    [FSDSS-148]Chased To The Limit Minori Kawana

  • real village henan censoredcreampiebeautiful girlFSDSSfalenozampafaleno starFSDSS-148FSDSS1481fsdss00148
    • 2020-12-25
    65 min

    [DHT-135]A More-Than-20-Years-Age Gap May-December Romance Set Up On A Hookup App Seducing Girls Who Love Withered Old Men Chiharu 21 Years Old

  • censoredamateurbeautiful girlDHThot entertainmententhusiastDHT-135DHT13559dht00135
    • 2021-01-23
    119 min

    [NNPJ-428]"You Seduced Me Because You Want To Fuck Me, Right？ Well Okay Then!" Her Boyfriend Committed Infidelity, And Now, She Just Wants To Get Fucked By Somebody... She's Frustrated And Making Her Adult Video Debut Her Tanlines Are Sup

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-428NNPJ428nnpj00428
    • 2021-01-24
    59 min

    200GANA-2424 In the spear room of the Nampa master of 100 battles, bring in SEX hidden shooting 189 Succeeded in bringing a model-class beauty who attracts attention from the surroundings to the spear room just by drinking alcohol! Sensitive Oma who

  • amateur censoredbig titsamateurganagana-2424gana2424200gana-2424
    • 2021-02-01
    56 min

    345SIMM-601 A video of a fascinating slender married woman (mother-in-law) seducing her at home every day and taking a gonzo

  • amateur censoredcreampiemarried womansimmsimm-601simm601345simm-601
    • 2021-02-09
    59 min

    SIRO-4414 [First shot] [Anime voice baby-faced girl] [Bounce and die sensitive body] A young girl with an anime voice that leaves innocence. She is a fresh and sensitive body, she can not resist her pleasure that attacks her for the first time and re

  • amateur censoredamateursirosiro-4414siro4414siro-4414
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-21
    116 min

    [HND-948]She's Lifting Her Creampie Ban For The Very First Time You Get To Exclusively Rent A Former Idol For 2 Days And 1 Night And Have Infinite Creampies Until Your Time Runs Out A Hot Spring Resort Vacation Special Featuring 10 Ejaculations F

  • minano sora censoredcreampieblowjobHNDhon nakatiger kosakaiHND-948HND948hnd00948
    • 2021-03-12
    88 min

    TNS-001 Sara

  • amateur censoredamateurtnstns-001tns001tns-001
    • 2021-03-13
    119 min

    [EBOD-812]More Than Masturbation But Less Than Lovers Sexfriend With Beautiful Tits And A Tight Pussy Lets Me Fuck Her When We Meet - Rui

  • censoredcreampiebig titsEBODe bodymichiru arashiyamaEBOD-812EBOD812ebod00812
    • 2021-03-18
    58 min

    FC2PPV 1730846 Big boobs world tremor! Miraculous I Cup Ubu Bishoujo First Leak [Limited Premier]

  • amateur uncensoredfc2
    • 2021-03-27
    119 min

    [MRSS-109]"Let's Go To The Aquarium Again Next Year..." My Beloved Wife Signed Up To Be A Cum Receptacle For A Rich Family For A Year To Make Money For My Son's Surgery Yu Shinoda

  • shinoda yu censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-109MRSS109mrss00109
    • 2021-03-27
    130 min

    [VEO-040]Real Amateur Married Woman Porn Star Debut! This Slutty Angel From Fukuoka Is A Slender Nurse...First Time Affair Sex Karina Ayami

  • karina ayamizu censoredcreampiemature womanVEOvenuskaniebornVEO-040VEO040veo00040
    • 2021-04-14
    63 min

    SIRO-4484 [First shot] [Beautiful breasts nice ass cowgirl] [Immoral licking] The daughter of a long-established dry goods store that has continued for generations is the first rebellious period. Kimono that is usually well protected .. Application a

  • amateur censoredbig titsamateursirosiro-4484siro4484siro-4484
    • 2021-04-24
    131 min

    [MRSS-111]My Big Booty Wife Protected Me From Thugs, And They Ended Up Taking It Out On Her Body... Ema Asahi

  • chaoyang ema censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-111MRSS111mrss00111
    • 2021-04-30
    71 min

    259LUXU-1422 Luxury TV 1398 A Beautiful Big Tits Nurse Appears In An AV In Search Of Passionate Sex! Obscenely bewitchingly disturbed with all one’s heart … Squirting cum with so much pleasure!

  • amateur censoredbig titsamateurluxuluxu-1422luxu1422259luxu-1422
    • 2021-05-14
    31 min

    FC2PPV 1817736 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] Massive squirting with a huge dildo ♥ ️ Fair-skinned plump body ♥ ️ Massive vaginal cum shot! !! ♥ ️ * Review benefits / Squirting masturbation ♥

  • amateur uncensoredfc2
    • 2021-05-14
    60 min

    FC2PPV 1811793 [No] It seems that she wanted to have sex with a sober and potato female college student, a 20-year-old whip whip body, and an uncle. [Individual shooting]

  • amateur uncensoredfc2
    • 2021-05-21
    60 min

    494SIKA-089 Make A Pet Of A Countryside De M Kyaba

  • amateur censoredcreampieamateursikasika-089sika089494sika-089
    • 2021-05-22
    243 min

    [NASH-510]My Stepson Is Over 20 Years Old, But We Still Bathe Together. The Truth is, I Also Take Care Of His Sexual Needs, And It's Been Several Years Since We Started Sexual Relations ... Is This An Extreme Case of Overprotectiveness？

  • mika ichijo asagiri hikari censoredmature womanslutNASHnadeshikojun nagasawaNASH-510NASH510nash00510
    • 2021-05-29
    141 min

    [MKON-053]My MILF Stepmom Is Young And Adorable, And Although I Could Never Tell Her To Her Face, I Like Her A Lot, And I've Always Hoped That She Would Never Get Remarried Hono Wakamiya

  • honoka wakamiya censoredcreampiebig titsMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-053MKON053mkon00053
    • 2021-06-10
    119 min

    [HBAD-585]A Mother Was Made To Have Sex With Her Son's Friends To Relieve Their Sexual Desire And Ended Up Being Covered In Semen Ayano Fuji

  • ayano kato censoredmomsingle workHBADhibinodragon nishikawababeHBAD-585HBAD5851hbad00585
    • 2021-06-26
    240 min

    [JKSR-499]@Shinjuku - Rural Wives Only - Picking Up Girls At The Bus Terminal Who've Got Reasons To Cheat 12 Girls, 4 Hours 2

  • censoredamateurJKSRbig morkalobockeyprink junkyJKSR-499JKSR49957jksr00499
    • 2021-08-12
    125 min

    [FSDSS-267]Masochist Men Specialty Massage Parlor Where They Juice Your Cock Even After Cumming, Sora Amakawa

  • tenkawa sora censoredbig titshandjobFSDSSfalenozack araifaleno starFSDSS-267FSDSS2671fsdss00267
    • 2021-08-14
    175 min

    [KAGP-193]Amateur Girl Is Actually Amazing At Blowjobs, 10 Modern Amateurs Met Online, 180 Minutes

  • censoredamateurblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-193KAGP193kagp00193
    • 2021-09-03
    64 min

    SIRO-4615 [First Shot] [Cleavage] [Squirting A Lot] Marunouchi Ol Who Has Good Quality And Eros Has Appeared. A Neat Office Lady Carefully Licks Her Cock While Making An Obscene Sound, And When It Is Inserted In The Vagina, It Exposes A Foolery In Fr

  • amateur censoredsquirtingamateursirosiro-4615siro4615siro-4615
    • 2021-09-10
    118 min

    [IPX-729]To Whom It May Concern: "I Slept With My Brother"s Wife." My Sister-In-Law Is A Secret Dick-Sucking Slut. She Lives Out In The Country By The Sea. While My Brother Was Away, I Banged Her. Nanami Misaki

  • nanami misaki censoredblowjobsingle workIPXidea pocketzampadishIPX-729IPX729ipx00729
    • 2021-10-02
    59 min

    519MAZOF-018 [Training Pickled] School Teacher 26 Years Old A Female Teacher With A Outrageous Perverted Sexual Desire, A Masochist Female Creampie Sexual Intercourse (Megumi Mizumori)

  • amateur censoredcreampieamateurmazofmazof-018mazof018519mazof-018
    • 2021-10-22
    121 min

    [HMN-070]Looking Like Someone Else At First. This AV Actress Looks Kind Of Like My Girlfriend... An All-day Date Turns To Jealousy And A Whirlwind Of Overconfidence That Ends In A Serious Creampie Load. Aoi Kururgi

  • aoi kururugi censoredcreampiebeautiful girlHMNhonnakatanaka baconHMN-070HMN070hmn00070
    • 2021-10-23
    75 min

    FC2PPV 2367489 (Personal Shooting Of Appearance) Staying At A Luxury Hotel With A Mature Woman In The Neighborhood Ejaculation 7 Times With Affair Sex

  • amateur uncensoredfc2
    • 2021-10-23
    107 min

    [APNS-261]Falling For Lusty Older Men... Pure Innocent Big Tits Hottie Wet From Old Spit, Hono Konomi

  • yoshimi hono censoredcreampieschoolgirlAPNSaurora project annexnasu yukihiroAPNS-261APNS261apns00261
    • 2021-10-25
    41 min

    274DHT-0320 The Turbulence Of A Fair-Skinned Busty Wife. Married Couple Exchange! Cuckold Swapping Gangbang

  • amateur censoredcreampiebig titsdhtdht-0320dht0320274dht-0320
    • 2021-11-04
    119 min

    435MFC-156 ["Please Sperm Me Too ♪" Impure Physical Relationship With Big Breasts Teacher] Affair Etch Without Waiting For Family Collapse With My Son’S Teacher ♪ Excellent Sensitivity M Temperament Does Not Stop The Tide! !! Condom Conf

  • amateur censoredcreampiebig titsmfcmfc-156mfc156435mfc-156



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies