def censored cowgirl javcensored sister




FC2SSISAMBISPRDHUNTBSSNIHDKANACXMILKPPPDAWDCESDHNDGMEMVEMAAVSADASDEBODVENXADNLULU

2020-11-22
39 min

FC2PPV 1579589 [First time limited 1980] Pretending to be neat and hidden Bitch F cup beautiful breasts office worker ❤️ Seeking stimulation for the first time in a long time in a self-restraint period ❤️ I squeezed sperm with a nasty pussy ❤️ * Ther

  • amateur uncensoredfc2
    • 2020-11-27
    120 min

    [NEM-048]New Kinky Sex 2 - MILF In Her Fifties Craves Her Stepson's Cock Iku Kondo

  • satoshi kondo satomi kondo censoredbig titsmature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-048NEM048143nem00048
    • 2020-11-27
    185 min

    [BAZX-258]The Creampie Idol Sleeps Her Way To The Top vol. 012

  • censoredcreampieuniformBAZXbazookatodoBAZX-258BAZX258h-1496bazx00258
    • 2020-12-04
    52 min

    [oretd-807]NAKAJOU

  • amateur censoredcreampieamateuroretdoretd-807oretd807oretd-807
    • 2020-12-05
    136 min

    [JUL-402]Whether I Fight With My Friends, Or My Girlfriend Dumps Me, My Stepmom's Tits Are Always There To Wipe Away My Cares... Hana Haruna

  • haruna hana censoredmature womansingle workJULmadonnamametaro mamezawaJUL-402JUL402jul00402
    • 2020-12-16
    62 min

    374SHOW-036 Mugi

  • amateur censoredamateurshowshow-036show036374show-036
    • 2020-12-18
    40 min

    [CLO-105]I'll Pinch You While Looking At You - Natsuko Mishima

  • natsuko mishima censoredbig titsblowjobCLOchobitchchovicCLO-105CLO105h-1435clo00105
    • 2020-12-24
    115 min

    [GUILD-171]雨宮留菜/従順彼女

  • amateur censoredGUILDGUILD-171GUILD171
    • 2020-12-29
    45 min

    H4610 ki210105 Norika Kurahashi 18years old

  • amateur uncensoredh4610
    • 2021-01-02
    60 min

    [KBTV-054]You Have A High Probability Of Being Able To Fuck A Woman You Met In A Mobile Game - A Theory

  • censoredcreampieamateurKBTVmessy tvKBTV-054KBTV054h-1514kbtv00054
    • 2021-01-11
    45 min

    362SCOH-023 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [● Red]

  • amateur censoredcreampieamateurscohscoh-023scoh023362scoh-023
    • 2021-01-14
    53 min

    C0930 ki210114 Namie Tamaki 38years old

  • amateur uncensoredc0930
    • 2021-01-15
    218 min

    [BAZX-267]POV Sex With A Beautiful Girl In Sailor Uniform vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-267BAZX267h-1496bazx00267
    • 2021-01-18
    48 min

    IDJS-030 Miki

  • amateur censoredcreampieamateuridjsidjs-030idjs030idjs-030
    • 2021-01-22
    153 min

    [PXH-019]This Girl Answered Our Ad # 003 # Sa-chan (20 Years Old) # From Miyazaki # Divine I-Cup Titties # She Loves To Be Spanked # A Colossal Tits Freelancer # She Cums When Choked # An Explosively Prematurely Cumming Babe

  • censoredcreampiebig titsPXHprestigeprestige hmjmPXH-019PXH019118pxh00019
    • 2021-01-23
    45 min

    H0930 pla0107 Kaori Toura 55years old

  • amateur uncensoredh0930
    • 2021-01-28
    108 min

    [SPRD-1367]I Like That Older Woman I Used To Do It With More Than My New Wife... Shoko Tokuyama

  • shoko tokuyama censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1367SPRD136718sprd01367
    • 2021-02-03

    FC2PPV 1669719 Limited [Individual] A wife who is called to a part-time inn and vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-02-06
    49 min

    H4610 ki210207 Akemi Kawase 25years old

  • amateur uncensoredh4610
    • 2021-02-11
    60 min

    [orec-689]かのん

  • amateur censoredcreampieamateurorecorec-689orec689orec-689
    • 2021-02-12
    220 min

    [SKMJ-147]Faces Totally Revealed We Seduced This Real-Life Nurse In A Real Pickup! This Angel In White Was Super Servicing Me And Curing Me Of My Impotence! This Nurse From The Internal Medicine Ward Is Giving Me A Total Body Licking, While The Nurse

  • censoredamateurSKMJred face girlkikufukuSKMJ-147SKMJ147h-1324skmj00147
    • 2021-02-17
    137 min

    [GVH-194]Trip With My Sexy Big-Titty Teacher! Exciting Three Day School Trip To The Hot Springs Yuria Yoshine

  • yoshine yuria censoredbig titsGVHglory questhyonGVH-194GVH19413gvh00194
    • 2021-02-26

    10musume 022621_01 Make You Feel Good With My Mouth Kanade Mio

  • amateur uncensored10musume
    • 2021-03-08
    57 min

    492MERC-244 Leave the content of the play to yourself

  • amateur censoredcreampieschoolgirlmercmerc-244merc244492merc-244
    • 2021-03-13
    116 min

    [MIAA-405]The Married Woman Next Door Lodges A Customer Complaint, But The Tables Are Turned When The Salesman Spots Evidence Of Her Affair - Ravished In Silence Siren So Her Husband Won't Know, Made To Take A Creampie Eimi Fukada

  • emi fukada censoredcreampiesingle workMIAAmoodyzinaballeveryone s porn starMIAA-405MIAA405miaa00405
    • 2021-04-02
    236 min

    [HUNTA-984]"Please...Let Me Put It In Just A Little!" The Worst...No, Best Woman Ever Finally Let Me Fuck Her After Asking Over And Over

  • censoredblowjobHUNTAhuntermorikihhh groupHUNTA-984HUNTA984hunta00984
    • 2021-04-12
    86 min

    300MIUM-697 G-Cup Pheromone Rolling Out A Trip With A Beautiful Woman! Even in Yokohama, the sacred place for dates, the lingerie clerk who has been throwing milk for a long time is too conspicuous and dangerous! !! A large amount of vaginal cum shot

  • amateur censoredcreampiebig titsmiummium-697mium697300mium-697
    • 2021-04-15
    123 min

    [BBTU-010]You'll Swoon With Pleasure! Breast Oil Massage, Slow Titty Fuck & Slow Sex Yuria Yoshine

  • yoshine yuria censoredbig titsblowjobBBTUdogmatenunmy boyneBBTU-010BBTU010bbtu00010
    • 2021-04-17
    181 min

    [AKID-083]@I Started My Sex Life!! #Takehome vol. 2

  • censoredAKIDomochikaeri mousozokumanji groupAKID-083AKID083akid00083
    • 2021-04-17
    239 min

    [REXD-359]We Discovered A Pervert In The Neighborhood! Woman Who Films Herself Masturbating Is Found Out By The Location Of Her Beauty Mark!

  • censoredcreampieblowjobREXDredmanji groupREXD-359REXD359rexd00359
    • 2021-04-18
    125 min

    [GMEM-029]Masochistic Plump Wife With Big Tits Gets Turned Into A Slut Sex Doll Awakening Haruna Wakatsuki

  • haruna wakatsuki censoreddeepthroatsingle workGMEMavs collector sbuddha davscollector s goldGMEM-029GMEM029gmem00029
    • 2021-04-21
    60 min

    FC2PPV 1780259 Relieve self-restraint and release stress for both men and women! Continuous vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-28
    55 min

    517MQXT-009 Cruel Anal Naburi Attacking A Neat Lady

  • amateur censoredanalamateurmqxtmqxt-009mqxt009517mqxt-009
    • 2021-05-20
    97 min

    [VNDS-3367]A Stepmom Finds Her Stepson Jerking Off To Her Underwear, So She Sucks His Cock For Him 3

  • shigeko nagata aira sonokawa censoredblowjobmature womanVNDSstar paradisenext11VNDS-3367VNDS3367h-254vnds03367
    • 2021-05-21
    60 min

    230OREC-767 Arisa-san

  • amateur censoredcreampiebig titsorecorec-767orec767230orec-767
    • 2021-06-08
    189 min

    [KIRE-046]Super Sensitive Body That Catches Fire During Sex Real Life Cafe Worker Hinano Okada 27 Years Old Porn Debut

  • hinano okada censoredsingle workKIREsod createdainanabeauty kirei sodKIRE-046KIRE0461kire00046
    • 2021-06-15
    47 min

    481SACZ-038 Sachiyo 4

  • amateur censoredamateurmature womansaczsacz-038sacz038481sacz-038
    • 2021-06-18
    66 min

    SIRO-4480 [First shot] [God-friendly idol smile] [Innocent and plump round butt] A baby-faced beautiful girl college student who also has experience as an underground idol. An innocent smile turns into an obscene crying face, and a small body full of

  • amateur censoredamateursirosiro-4480siro4480siro-4480
    • 2021-06-24
    140 min

    [HAWA-250]"Y********ls Just Want To Suck Dick!" Plump Slutty Housewife Kozue Happily And With Expert Use Of Her Tongue Slurps Dick Younger Than Her Husband's

  • censoredamateurblowjobHAWAkosumosu eizouhide monkcosmospictures soft on demandHAWA-250HAWA2501hawa00250
    • 2021-08-25
    101 min

    459TEN-024 [Hcup Fucking Goddess] Assault On The Home Of An H-Breasted Spear Man Gal Captured In Shibuya! !! Bombshell Fuck With Special Game Underwear! !! Hami Milk That Does Not Fit In The Game Underwear Is Erotic To The Strongest Level Ever! A Sma

  • amateur censoredcreampiebig titstenten-024ten024459ten-024
    • 2021-08-31
    54 min

    H4610 ki210831 Nanako Sugizaki 19years old

  • amateur uncensoredh4610
    • 2021-09-07
    67 min

    FC2PPV 2172477 * Limited Time Price Until 9/13 [2480pt⇒1980pt] Loli Face Big Milk ★ H Cup Female College Student (19) ★ Love Love Squirting Sex With Older Boyfriend [4k Benefits Available]

  • amateur uncensoredfc2
    • 2021-09-10
    122 min

    [RKI-618]All New Bucketloads Of Bukkake Minami Hatsukawa

  • hatsukawa minami censoredcreampiebeautiful girlRKIrookieRKI-618RKI618rki00618
    • 2021-10-28
    110 min

    [AARM-028]The Thighs of a Married Woman. Rubbing Thighs That Feel So Good

  • alice toyonaka miu susaki censoredmature womanAARMaroma kikakukadowaki shigeoaromaAARM-028AARM028aarm00028
    • 2021-11-05
    173 min

    [SSIS-230]Shitty Masochistic Man and Miru Left Alone in House in Suburbs. Made a Slut Every Second of Day for 3 Days

  • miru censoredslutsingle workSSISs1 no 1 stylesamoariSSIS-230SSIS230ssis00230
    • 2021-11-22
    66 min

    OREX-324 Miku-chan (Miku Kurusu)

  • amateur censoredcreampieschoolgirlorexorex-324orex324orex-324
    • 2021-11-26
    44 min

    FC2PPV 2452784 [Miracle Life 3p! ] A Super Young Babysitter With A Loli Body Who Lives With A Married Woman Who Still Breastfeeds After Giving Birth [Discount Until Monday]

  • amateur uncensoredfc2



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies