cosplay digital mosaic high vision javcensored censored




FC2KBIHUNTBSPRDJUFESSNIJULMILKHDKASSISMIAAAWDSQTEADNGMEMMEYDKSBJATIDONEZLULUROYD

2022-02-18
120 min

[HMN-122]Unveiled 20-Year-Old Cute And Stylish S*****t Studying Fashion. Putting On Lewd AV-Style Cosplay For A First-time Creampie. Maina Shiki

  • shiki maina censoredcreampiecosplayHMNhon nakamametaro mamezawaHMN-122HMN122hmn00122
    • 2022-02-04
    132 min

    [IPX-813]Reverse Bunny Costume Play Situations With Exposed Tits. Max Volume. Momonogi"s 10 Erotic Changes! Kana Momonogi

  • kana momonogi censoredcosplaysingle workIPXidea pocketinaballdishIPX-813IPX813ipx00813
    • 2022-01-14
    199 min

    [MUKC-020]Sick Kawaii Idol Love Hotel Secret Meeting Video, Exposing Her Instincts In A Graphic Cosplay And Off-camera Nakadashi Hanagari Mai

  • flower hunting censoredcreampiecosplayMUKCmukuinnocent cosplayMUKC-020MUKC020mukc00020
    • 2022-01-14
    148 min

    [MIDV-036]Our S*****t Council President, Sakura-chan, Decided To Build A Soapland Club, And Now She" Getting Busy In A Sexy Outfit! Unlimited Ejaculation Services Sakura Miura

  • minamata sakura censoredbig titsschoolgirlMIDVmoodyzkyoseimoodyz divaMIDV-036MIDV036midv00036
    • 2022-01-14
    153 min

    [MIAA-562]If You Have Money, You Can Do It! Girls With Big Tits Buying Large Amounts Of Creampie. Kokona Asakura. Kasumi Tsukino.

  • kasumi tsukino asakura here censoredcreampiebig titsMIAAmoodyzryo gokuminna no kikatanMIAA-562MIAA562miaa00562
    • 2021-12-17
    165 min

    [MUKC-019]A Cute Underground Idol Who Makes Men Fall In Love With Her, A Secret Off-package Pillow Fight, Creampie OK, Cosplay Sex, Cum Crazy 6 Times, Nanami Yokomiya

  • yokomiya nanami censoredcreampiecosplayMUKCmukuinnocent cosplayMUKC-019MUKC019mukc00019
    • 2021-11-05
    150 min

    [URE-074]Ryou Ayumi Is Ripe For Picking! - Original Story: Minamoto - I Shouldn"t Have Deceived My Wive And Gone To That Event

  • ayumi ryo censoredcosplaymature womanUREmadonnakitorune kawaguchiure komiURE-074URE074ure00074
    • 2021-10-29
    119 min

    [MIAA-524]W Reverse Bunny Slut And Reverse 3P Creampie Harem SEX Himari Kinoshita and Hinako Mori

  • himari kinoshita himari hanazawa hinako mori censoredcreampiecosplayMIAAmoodyzoosaki hirokoujiminna no kikatanMIAA-524MIAA524miaa00524
    • 2021-10-22
    116 min

    [HMN-066]When The Popular Adult Video Actress Hotaru Nogi Wants To Fuck, She"ll Dress Up in Cosplay And Go Out On The Town On An Amateur Reverse Pick Up Rampage, Searching For Fuck Buddies On Social Media, And Going Offline For Creampie Fuck Fest

  • nogi firefly censoredcreampiebig titsHMNhonnakataiga kosakaiHMN-066HMN066hmn00066
    • 2021-10-15
    118 min

    [MUKC-018]Indecent Time: A Frustrated Beautiful Girl Idol Giving A Blowjob In The Kitchen - Hana Shiromomo

  • white peach censoredblowjobcosplayMUKCmukumuku kosuMUKC-018MUKC018mukc00018
    • 2021-09-10
    149 min

    [IPX-724]"I Didn"t Want To Fuck, But I Got Fucked Anyway ..." They Came For Her, One After Another ... A Noble Race Queen Falls Prey To A Chain Reaction Baton Passing Relay Of Sex Karen Kaede

  • karen kaede censoredcosplaybeautiful girlIPXidea pocketzaku araidishIPX-724IPX724ipx00724
    • 2021-08-06
    118 min

    [IPX-701]"I Was Fucked Hard..." One After The Other... Baton- Fucked Race Queen Iyona Fujii

  • iyo fujii censoredcosplaysingle workIPXidea pocketzack araitissueIPX-701IPX701ipx00701
    • 2021-07-22
    174 min

    [MIAA-474]Welcome To The Bunnygirl Soapland Where You Can Cum Inside Tanned Girls! ~ Filling A Rough-Talking Tanned-Ass Usachan In Heat With Cum! ~ REMI

  • remi censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-474MIAA474miaa00474
    • 2021-07-09
    161 min

    [MUKC-017]Sickly-cute Idol Secret Love Hotel Meeting Graphic Cosplay And Meetup for Sex That Will Expose Your Instincts Maika Hizumi

  • maika hizumi censoredcreampiecosplayMUKCmukumuku kosuMUKC-017MUKC017mukc00017
    • 2021-06-25
    119 min

    [MIAA-457]My Erection Was So Huge, It Was About To Tear Through These Paper Underpants ... I Went To A Rejuvenation Men's Massage Parlor And This Girl With A Slender Body In An Excessively Hot Outfit Kept On Giving Me Nookie Over And Over And Ove

  • white peach censoredcreampiecosplayMIAAmoodyzcaptain eharaeveryone s porn starMIAA-457MIAA457miaa00457
    • 2021-06-11
    150 min

    [MIAA-448]Hot Cosplay And A Pussy Juice Slurping Older Man Film Themselves Fucking At A Love Hotel On Aphrosiacs (Saliva-Swapping Kisses) (Hot Hard Anal Rimming) (Back-To-Back Fucks)

  • censoredcreampiebig titsMIAAmoodyzeveryone s porn starMIAA-448MIAA448miaa00448
    • 2021-04-09
    130 min

    [MUKC-016]Squirting Nanase Asahina Asahina Nanase

  • asahina nanase censoredcreampiesquirtingMUKCmukuinnocent cosplayMUKC-016MUKC016mukc00016
    • 2021-02-27
    161 min

    [MIDE-891]Alone With Minami Hatsukawa, Tempting Me By Whispering Slutty Dirty Things In My Ear - 6 Situations Behind Closed Doors

  • hatsukawa minami censoredcreampiecosplayMIDEmoodyzhirokoji osakimoodyz divaMIDE-891MIDE891mide00891
    • 2021-02-12
    117 min

    [MUKC-015]A Famous Cosplayer's Cosplay Sex - Eimi Fukada

  • emi fukada censoredcreampiecosplayMUKCmukuinnocent cosplayMUKC-015MUKC015mukc00015
    • 2020-11-13
    120 min

    [MIDE-848]Buxom Investigator -- Undercover At A Cosplay Photography Event -- Sakura Miura

  • minamata sakura censoredbig titscosplayMIDEmoodyzkitorune kawaguchimoodyz divaMIDE-848MIDE848mide00848
    • 2020-10-03
    119 min

    [JUL-337]Tonight, I May Finally Be Able To Lose My Virginity. Tsubaki Kato

  • kato camellia kaoru natsuki censoredcosplaymature womanJULmadonnainaballJUL-337JUL337jul00337
    • 2020-07-11
    164 min

    [MIDE-801]J-Cup Colossal Tits Covered In Cocks - Pounded To Intense Climaxes - Her First Large Orgies & Cosplay Special Kana Kusakabe

  • kana kusakabe censoredbig titssquirtingMIDEmoodyzzaku araimoodyz divaMIDE-801MIDE801mide00801
    • 2020-03-08
    180 min

    [IPX-456]A Freshly-Ejaculated Sensual Penis, I'm Not Going To Let It Go To Waste, So I'm Going To Suck It Down Hard Nanami Misaki

  • nanami misaki censoredblowjobcosplayIPXidea pocketnao masakidishIPX-456IPX456ipx00456
    • 2020-02-01
    148 min

    [URE-055]First Live Action Adaptation! - Presented By Madonna - Nao Jinguuji In "Sunflowers Bloom At Night" - Original Work By Hiromitsu Takeda

  • jinguji temple nao censoredcosplaymature womanUREmadonnakitorune kawaguchiure.comiURE-055URE055ure00055
    • 2019-10-26
    183 min

    [MIDE-696]G Cup Pin Up Girl Cosplayer Orgy After Party Shoko Takahashi Shoko Takahashi

  • shoko takahashi censoredbig titscosplayMIDEmoodyzcountac maedamoodyz divaMIDE-696MIDE696mide00696
    • 2019-10-06
    180 min

    [IPX-383]Cum Squirting Sensitive Cock, Today Let's Suck It Non-Stop! Karen Kaede

  • karen kaede censoredblowjobcosplayIPXidea pocketnanzaki masakitissueIPX-383IPX383ipx00383
    • 2019-10-06
    118 min

    [IPX-382]A Braless And Pantyless See-Thru Cosplay Outfit A Divine Idol Reflexology Salon "We Have Secret Optional Services (Fucking), As Long As You Promise To Keep This A Secret..." Kokona Yuzuki

  • yuzuki shinna censoredblowjobsingle workIPXidea pocketzach araitissueIPX-382IPX382ipx00382
    • 2019-09-22
    149 min

    [TCD-238]Would You Like To Have Ass Pussy Sex With A Cute Cosplay She-Male & Reverse Anal Sex？ An Exclusive She-Male Actress Azusa Himeyuri

  • himeyuri censoredcosplayslutTCDtrans clubTCD-238TCD238tcd00238
    • 2019-09-08
    121 min

    [MUDR-084]Tsun M! Squeeze Me Tight And Give Me Instructions! Live Action Edition - Rui Hizuki

  • rui hizuki censoredcreampiecosplayMUDRmukuMUDR-084MUDR084mudr00084
    • 2019-06-29
    123 min

    [BOBB-318]Hono Wakamiya Dear Master, Please Fuck My Tits Up... An Innocent Beautiful Girl With Big Tits Is Getting Trained For Perversion

  • honoka wakamiya censoredbig titscosplayBOBBabc mousouzokuboinbb abcBOBB-318BOBB318bobb00318
    • 2019-06-23
    156 min

    [TCD-226]Super Cute Trap Shows Penis Clit Huge Cumshot 4 Sex Exclusive Trap Actress Mari Momo

  • peach mari censoredcosplayslutTCDtrans clubTCD-226TCD226tcd00226
    • 2019-06-22
    150 min

    [HND-679]H Cup Sexy Cosplay College Girl Starts Working At Top Class Creampie Soapland Rio Ishihara

  • ishihara censoredcreampiebig titsHNDhon nakausa pyonHND-679HND679hnd00679
    • 2019-05-25
    117 min

    [MIDE-655]Fuck Temptation Sensitive Hostess Gets Wet From Blowjob Minami Hatsukawa

  • hatsukawa minami censoredblowjobcosplayMIDEmoodyzzaku araimoodyz divaMIDE-655MIDE655mide00655
    • 2019-05-11
    239 min

    [IPX-304]Super Luxurious Full Course At The Massage Parlor With A Real Celebrity. A Celebrity All To Yourself! 4 Sex Scenes, 240 Minutes. Wholehearted Service Special. Kokna Yuzuki

  • yuzuki shinna censoredcosplaybeautiful girlIPXidea pocketmon cdishIPX-304IPX304ipx00304
    • 2019-02-09
    116 min

    [MUDR-068]A Beautiful Girl With Amazing Skin And The Perfect Body Will Service You. Bareback Sex And Creampies At A Pitakosu Soapland. Emiru Mizukawa

  • emi mizukawa censoredcreampiecosplayMUDRmukuMUDR-068MUDR068mudr00068
    • 2018-12-09
    197 min

    [IPX-237]4 Ultra Orgasmic Sweaty And Drooling Fucks Mika Kurosaki

  • kurosaki mika censoredcosplaybeautiful girlIPXidea pocketkyoseidishIPX-237IPX237ipx00237
    • 2018-12-09
    162 min

    [MUDR-059]I Invented A Drug That Allows Me To Control Girls. The Principal's After-School Research Project. Akari Mitani, Sakura Kirishima

  • mitani akari kirishima sakura censoredcreampiebig titsMUDRmukuMUDR-059MUDR059mudr00059
    • 2018-12-06
    147 min

    [PRED-113]My Sophisticated Female Boss's Stand-In Cosplay Creampie Shoot. Riri Hosho

  • hosei lily censoredcreampiebig titsPREDpremiumtequilia tinoelegancePRED-113PRED113pred00113
    • 2018-11-10
    118 min

    [MIMK-062]Big Sister Cosplay ~My Big Sister's Cosplay Is So Hot, I'm Running Out Of Jizz~ Ai Sayama

  • sayama love censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-062MIMK062mimk00062
    • 2018-10-27
    171 min

    [MIDE-592]The Total Domain Temptation Of A Super Horny Elder Sister In Knee-High Socks Tsubomi

  • bud censoredcosplayslutMIDEmoodyzhirokoji osakimoodyz divaMIDE-592MIDE592mide00592
    • 2018-08-16
    119 min

    [MVSD-359]Rich Middle-Aged Men Can! Tennis Club Co-eds Creampie An Mita Mari Takasugi

  • miharu kawada anri mita mari takasugi censoredcreampiecosplayMVSDm s video groupkindaichishougo rouMVSD-359MVSD359mvsd00359
    • 2018-04-21
    117 min

    [HND-506]We Met This Half-Taiwanese Exchange Student With A Full Body Erogenous Zone At A Taiwanese Restaurant Who Loves Japan And Can Cum In 4 Different Languages And Now She's Making Her AV Debut!! Rin Vivian

  • vivian lin censoredcreampiebig titsHNDhonnakahiroaHND-506HND506hnd00506
    • 2018-03-19
    120 min

    [XVSR-352]Welcome to MaxCafe! Mami Nagase Enjoy Mamin's Special Menu

  • asami nagase censoredbig titsschoolgirlXVSRmax ashanty yazawacalenXVSR-352XVSR352xvsr00352
    • 2018-02-03
    119 min

    [MVSD-343]Wealthy older men can do it! Tennisser JD buying everything. Creampie Misato Kannan Juri Mitani

  • real village henan mitani akari censoredcreampiecosplayMVSDm s video groupkogoro kindaichiMVSD-343MVSD343mvsd00343
    • 2018-01-27
    179 min

    [MIDE-506]For VIPs Only An Ultra High-Class See-Through Underground Sex Club JULIA

  • julia censoredcosplaysingle workMIDEmoodyzichigoharamoodyz divaMIDE-506MIDE506mide00506
    • 2017-12-30
    121 min

    [MIDE-499]We Get Back at the Cosplay Princess Who Betrayed Us - Minami Hatsukawa Clothed Confinement and Boys Club Gang Bang

  • hatsukawa minami censoredcosplaydeepthroatMIDEmoodyzgoemonmoodyz divaMIDE-499MIDE499mide00499
    • 2017-12-09
    117 min

    [MIFD-024]A Members Only Private Film Session Held Every Friday Where We Can Enjoy The Discovery Of A Hot And Horny Beautiful Girl Cosplayer!! When We Try To Get A Private Film Session With Her, She Said, "I Want You To Film Me In Sexy Poses...&q

  • censoredamateurcosplayMIFDmoodyztaiga kosakaiMIFD-024MIFD024mifd00024
    • 2017-11-23
    180 min

    [IPX-058]Fetish Freaks Hiding Out In Everyday Life Erotic Situations Cum To Life On Video! Minami Aizawa

  • minami aizawa censoredcosplaybeautiful girlIPXidea pocketinnabarIPX-058IPX058ipx00058



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies