cine magic




FC2SDABADNSANBLKHUNTBSSISHMNHNDFSDSSNATRMILKDTTMEYDMIAASQTEVENXWAAASHKDWANZATID

2020-10-23
239 min

[SIM-095]"If Our Stepmom And Stepdad Found Out, We'll Be In Serious Trouble" I Had Plenty Of Creampie Sex With My Beloved Little Stepsister

  • censoredcreampieschoolgirlSIMprestigeno directoramateur pussiesSIM-095SIM095118sim00095
    • 2020-10-23
    71 min

    483HMHI-577 [Ah, the legend of Decameron! !! Faint in agony with the rumored explosion ♪ Ai cup 105cm loving serious Nukinuki TIME] Locally produced unfussy snow-skinned fair-skinned girl Sachiko’s nature is a carnivorous monster seeking a lovin

  • amateuramateur censoredamateurhmhihmhi-577hmhi577483hmhi-577
    • 2020-10-31
    192 min

    [MIAA-339]Throat Destruction, Esophageal Agony, Hardcore Cum Swallowing, Deep Throat Misuzu Kawana

  • misuzu kawana censoredblowjobdeepthroatMIAAmoodyzkindaichishougo rouminna no kikatanMIAA-339MIAA339miaa00339
    • 2020-11-01

    FC2PPV 1554441 Limited number [No] Animal beautician, continuous vaginal cum shot while favorite electric vibrator (45 minutes)

  • amateur uncensoredfc2
    • 2020-11-06
    477 min

    [OFJE-281]Yua Mikami x Shame Special This National-Grade Idol Is Getting Continuously Fucked 8 Hours

  • yua mikami censoredbeautiful girlsingle workOFJEs1 no 1 styleOFJE-281OFJE281ofje00281
    • 2020-11-20
    488 min

    [MTM-018]We Seduced Amateurs Off The Street! A Serious Seduction Of A College Girl. 20 Big Tits Babes Best Hits Collection

  • censoredbig titsamateurMTMprestigemegatra maxMTM-018MTM018118mtm00018
    • 2020-11-22
    164 min

    [CAWD-147]Sex With You Tall Girl Taking 30 Creampie Cumshots Teacher Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workCAWDkawaiiCAWD-147CAWD147cawd00147
    • 2020-12-15
    197 min

    [PYM-360]Cock-Crazed Extreme Orgasms, Hard Piston Dildo Masturbation

  • censoredPYMprimoPYM-360PYM360h-283pym00360
    • 2021-01-06
    59 min

    [sika-014]あーちゃん 2(18)

  • amateur censoredbig titssquirtingsikasika-014sika014sika-014
    • 2021-01-09
    145 min

    [IPX-597]The Ultimate Lover - Pussy Juice, Saliva, Sweat, Squirting - Passionate Sex Slathered In Carnal Instinct Momo Sakura

  • sakura sky momo censoredbig titsslutIPXidea pocketdishIPX-597IPX597ipx00597
    • 2021-01-10
    125 min

    [SQTE-353]Beautiful Girl Tomboy Likes To Tease But She Also Likes To Cum Mana Hirade

  • hirate mana censoredblowjobbeautiful girlSQTEs cuteSQTE-353SQTE353sqte00353
    • 2021-01-11
    36 min

    362SCOH-029 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Mu]

  • amateur censoredcreampieamateurscohscoh-029scoh029362scoh-029
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    103 min

    [HZGD-176]Creampie Cheat Tour With A Beloved Mistress - Nene Tanaka

  • nene tanaka censoredcreampiebig titsHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-176HZGD176h-1100hzgd00176
    • 2021-01-23
    63 min

    FC2PPV 1655827 [Complete first shot x marshmallow boobs] Healing girl with a G cup that is too soft! Wrapped in fluffy boobs that everyone loves and sinks! ？？ I can not stand it and a large amount of vaginal cum shot * Complete appearance

  • amateur uncensoredfc2
    • 2021-01-29
    36 min

    [moj-008]カレン 2

  • amateur censoredcreampieamateurmojmoj-008moj008moj-008
    • 2021-01-31
    103 min

    [XVSR-574]I Can't Take It Anymore! Seduced Into Cheating Creampie Sex Under The Heater Blanket Kotone Suzumiya

  • kotone suzumiya censoredcreampieslutXVSRmax ak c takedacalenXVSR-574XVSR574xvsr00574
    • 2021-02-02
    60 min

    10musume 020221_01 The School Uniform: My Boobs Are Still Getting Bigger Since I Graduated Mai Maruyama

  • amateur uncensored10musume
    • 2021-02-11
    93 min

    [OKK-023]Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Runa Tsukino Enjoy A Cute Lolita In A Competitive Swimsuit To Your Heart's Content! Watch Them Change In Peeping Videos, And Check Out Their Tiny Titties, Big Tits, And Shaved P

  • tsukino luna censoredbeautiful girlsingle workOKKdaddy s private photosgodly swimming raceOKK-023OKK0231okk00023
    • 2021-02-16
    32 min

    FC2PPV 1688083 * For some reason, the sample hides the face. [4K] Main story appearance [Individual shooting] Private ordinary course FJK Delicate but raw insertion into a super baby-faced girl with E cup big breasts Gonzo w Hidden shooting → Natural

  • amateur uncensoredfc2
    • 2021-02-16
    64 min

    Pacopacomama 021621_435 This hot wife used to be a model Risa Aikawa

  • amateur uncensoredpacopacomama
    • 2021-02-22
    46 min

    FC2PPV 1697629 (Leaked) E-Cup Slender Big Breasts Pink Nipple Married Woman And Libido Explosion Condom Unnecessary NTR Dirty Talk Creampie Sex Receives Semen Of An Unknown Man In A Meat Pot (46 Minutes)

  • amateur uncensoredfc2
    • 2021-02-23
    132 min

    [SDAB-166]Relentless, Licking Kisses Saya Kuriyama

  • saya kuriyama censoreduniformsingle workSDABsodgoemonyouthSDAB-166SDAB1661sdab00166
    • 2021-03-04
    118 min

    [GS-2010]Sexual Massage Salon Voyeur 06

  • censoredGSgosGS-2010GS2010
    • 2021-03-07
    54 min

    FC2PPV 1679101 Yuko, an active cosmetologist who has an adult sex appeal ❤️ We are looking for someone who will change into naughty underwear and defeat the sexual desire monster that tempts you together.

  • amateur uncensoredfc2
    • 2021-03-09
    123 min

    [KTRA-279]A Limber-Limbed Slender Little Stepsister Gets Her Shaved Pussy Creampie Fucked Karen Junshin

  • innocent karen censoreduniformbeautiful girlKTRAk tribeKTRA-279KTRA279h-094ktra00279
    • 2021-03-15
    76 min

    FC2PPV 1711124 [G cup slime milk] I will expose private SEX with a big tits big butt gal w Blow with an erotic tongue with an open tongue is the best! Geki Yabahame shooting video that pierces from the top to the bottom and shakes the huge breasts

  • amateur uncensoredfc2
    • 2021-03-21
    120 min

    [JUL-507]The Story Of How I Spent Three Days Lovingly Fucking My Now Married Former Classmate When Visiting My Hometown Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanJULmadonnajo asagiriJUL-507JUL507jul00507
    • 2021-03-21
    39 min

    490FAN-078 Kokomi

  • amateur censoredbig titsamateurfanfan-078fan078490fan-078
    • 2021-04-01
    120 min

    [CLOT-017]Pantyhose Temptation - Mirei Aikawa

  • aikawa mirei censoredcosplaysingle workCLOTplanet plusdirector ocloseCLOT-017CLOT017h-237clot00017
    • 2021-05-02
    149 min

    [DNJR-050]She Wants To Domme And I Want To Be Dominated. I Was Suddenly Transferred To My Company's Lingerie Division And Seeing Me So Flustered Awakened My Coworker's BDSM Instincts - She Started Hitting On Me At Work Under The Guise Of &quo

  • inaba chiaki uehara censoredbig titsslutDNJRdog daydreamersmaboroshikoDNJR-050DNJR050dnjr00050
    • 2021-05-07
    143 min

    [IPX-652]Cheating On A Work Trip: Hot Female Employee Made To Cum By Her Hung Boss Miu Shiromine

  • shiramine miu censoredblowjobsingle workIPXidea pocketbungo maedadishIPX-652IPX652ipx00652
    • 2021-05-08
    106 min

    [APNS-239]My Beloved Wife Became A Toy For The Workers At The Bunkhouse ... Every Day, She Was Pumped With Their Cocks, And Had Her Mouth And Womb Filled With Their Semen ... Ayumi Manaka

  • ayumi aika censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-239APNS239apns00239
    • 2021-05-16
    104 min

    345SIMM-642 This is an overwhelming beautiful girl! National Idol Face! !! J ○ and love love birthday SEX with a super cute smile full of innocence! It’s an anniversary, so I want you to do it live. Two vaginal cum shots in a row … ？？ The t

  • amateur censoredcreampieuniformsimmsimm-642simm642345simm-642
    • 2021-05-20
    125 min

    [FSDSS-226]Arina, The Slutty Daddy's Girl Who Loves Slightly Masochistic Older Men Arina Hashimoto

  • there is hashimoto censoredsingle workFSDSSfalenomichiru arashiyamafaleno starFSDSS-226FSDSS2261fsdss00226
    • 2021-05-20
    121 min

    [FSDSS-231]For The Ultimate Masturbation Complete POV I Will Provide The Best Ever Masturbation Support Yui Shirasaka

  • yui shirasaka censoredblowjobcosplayFSDSSfalenokei isoifaleno starFSDSS-231FSDSS2311fsdss00231
    • 2021-06-04

    FC2PPV 1851483 Limited number [Uncensored] Plenty of vaginal cum shot on the sensitive body of a G cup slope girl! (Part 2) This is her last work …

  • amateur uncensoredfc2
    • 2021-06-05
    120 min

    [SOAN-059]This MILF Mama Of 2 Will Get Both Her Holes Domesticated Today ... This Seriously Amateur Housewife Is Thinking About Her Husband And How She Can Satisfy His Cuckold Desires, So She's Decided To Star In This Video Sanae Sekikawa (Not He

  • censoredamateurSOANyama to soramaketaro tanizokoanal visitSOAN-059SOAN059soan00059
    • 2021-06-20
    107 min

    [NSFS-003]New Atonement 4: Despite Everything, My Wife Won't Stop Devoting Herself To Me - With Ayano Fuji

  • ayano kato censoredmature womansingle workNSFSnagae stylenagaeNSFS-003NSFS003nsfs00003
    • 2021-06-29
    81 min

    274DHT-0115 I’m Sorry For The Etch … G Milk Wife’s Waist Swing Creampie Fuck Ran 31 Years Old

  • amateur censoredcreampiebig titsdhtdht-0115dht0115274dht-0115
    • 2021-06-30
    135 min

    [OVG-176]You Want Me To Jerk You Off With My Juicy Spit While We French Kiss Again？

  • kobayakawa reiko yuri sugawa censoredsluthandjobOVGglory questOVG-176OVG17613ovg00176
    • 2021-07-14
    120 min

    [SSIS-124]I Fuck The J-Cup Girl With A Dark Past Who Works At The Convenience Store Every Day, Morning To Night! Rara Anzai

  • anzai rara censoredbig titssingle workSSISs1 no 1 styleamazing meatSSIS-124SSIS124ssis00124
    • 2021-08-01
    126 min

    [AMBI-133]No Way! To Think That My Homeroom Teacher Would Discover The Dirty Images That I Transmit Online!! Rina Takase

  • rina takase censoredcreampieschoolgirlAMBIplanet plusdirector oanbibarentsuAMBI-133AMBI133h-237ambi00133
    • 2021-08-02
    116 min

    503KOO-017 Miu

  • amateur censoredbig titsamateurkookoo-017koo017503koo-017
    • 2021-08-16
    60 min

    SIRO-4600 [First Shot] [Baby Face X Huge Breasts] [Extreme Fucking] Discovered A Talented Man Who Is Sure To Receive H Cup Huge Breasts On His Baby Face. If You Show Off A Fucking That Gently Wraps A Big Cock And Insert It Into A Tightly Wet Secret P

  • amateur censoredbig titsamateursirosiro-4600siro4600siro-4600
    • 2021-09-09
    161 min

    [MIST-347]Right On Ovulation Day!! A Soapland Where You Can Make Babies 31 Kurea Hasumi

  • hasumi claire censoredbig titssingle workMISTmr michirusaitaMIST-347MIST3471mist00347
    • 2021-09-10
    152 min

    [JUL-699]Respectable Teacher For The Youth. 30-Year-Old H-Cup Married Woman That Teaches Youth For A Living Makes Her AV Debut!!

  • riame nagata censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-699JUL699jul00699
    • 2021-09-17
    72 min

    300NTK-634 [Echona Gal] [Swimsuit De God Style] [2 Squeezing Of Sexual Self-Restraint] Good Face And Good Style! !! Summer Memories With The Most Erotic Gal! !! The Sea Is Self-Restraint And Rampages In Love Hotels! !! I Am Deeply Moved By The Dirty

  • amateur censoredcreampieamateurntkntk-634ntk634300ntk-634



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies