broccoli delusion group




FC2SHKDGVHNNPJAUKGVENXHZGDCHRVMIAAHNDMEYDMARAADNFSDSSIPXSPRDWAAAAUKGAWDNGODATID

2020-12-24
86 min

[ykmc-045]まこ(23)

  • amateur censoredcreampiebig titsykmcykmc-045ykmc045ykmc-045
    • 2020-12-25
    88 min

    [SACA-017]My Younger Sister Has Such Flat Breasts!/Natsuki

  • censoredSACAorustak picturesSACA-017SACA017
    • 2020-12-26
    160 min

    [WAAA-025]My Condom Broke, And To Our Surprise, We Were Fucking In The Raw! As My Piston-Pounding Strokes Began To Accelerate, I Creampie Fucked Her Over And Over Again! Hinata Koizumi

  • hinata koizumi censoredcreampiebig titsWAAAwanz factorywanzWAAA-025WAAA025waaa00025
    • 2021-01-02
    42 min

    [opcyn-143]いのり(23)

  • amateur censoredcreampiebig titsopcynopcyn-143opcyn143opcyn-143
    • 2021-01-07
    69 min

    10musume 010721_01 Girl who longs for the entertainment world, came to the interview, so I had SEX Aiko Himeno

  • amateur uncensored10musume
    • 2021-01-15
    47 min

    FC2PPV 1645865 [Personal shooting] Ginza club mom raises funds to protect the store Enko! Raw insertion cum shot in glamorous big ass

  • amateur uncensoredfc2
    • 2021-01-20
    98 min

    300MIUM-671 [Can you tear off your nipples？ ] Unexpectedly pigmented adult nipples of an unfussy office lady who works for telework in a girly room are pulled around and played with, and the unbearable man who works from home shines in the sunshine.

  • amateur censoredbig titsamateurmiummium-671mium671300mium-671
    • 2021-01-24
    115 min

    [HYBR-010]School Report: The Hottest Girl On Campus Is Actually A Cross-Dresser Ai Sato ri

  • airi sato censoredschoolgirlsingle workHYBRhybrid films daydream tribedavielHYBR-010HYBR010hybr00010
    • 2021-01-29
    135 min

    [GYAN-011]Going On An Exhibitionist Date - Slut Loves To Fuck Outdoors "Go Ahead, Creampie Me" This Sweet, Horny Nympho Gives The Green Light To Cum Inside Her At The First Interview - Dildo-Bike Leads To Earth-Shattering Orgasms And Lust For

  • censoredGYANprestigehimurokkugyan prestigeGYAN-011GYAN011118gyan00011
    • 2021-01-31
    30 min

    FC2PPV 1666880 [Limited quantity 2400pt → 1200pt] Clear 2K super high quality Ver ❤️ uncensored video of a former lounge lady who was deceived by massage recruitment ❤️ There is a purchase privilege

  • amateur uncensoredfc2
    • 2021-02-07
    120 min

    [BKD-256]Family Fun [Okuyu Nishikawa Onsen Road] Narumi Sakagami

  • narumi sakagami censoredmature womansingle workBKDrubykoji tsujitobijiBKD-256BKD256bkd00256
    • 2021-02-17
    72 min

    [sika-031]こうちゃん(24)

  • amateur censoredcreampieamateursikasika-031sika031sika-031
    • 2021-02-27
    139 min

    [KNAM-035]Totally Raw Threesome [email protected] & Shizuku # Love Hotel Creampie Threesome Pay-For-Play Sex Hikari Is An Airheaded Lolita Big Tits Bitch x Shizuku Is A Neat And Clean Bashful Bitch

  • censoredcreampieschoolgirlKNAMfirstcompleteKNAM-035KNAM035h-491knam00035
    • 2021-03-13
    150 min

    [MIDE-899]A Female Teacher Gets G*******g Fucked - Escalating Shame - Ibuki Aoi

  • aoi ibuki censoredsingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-899MIDE899mide00899
    • 2021-03-16
    61 min

    Caribbeancom 031621-001 I’ma get wet!! Rei Kitajima

  • rei kitajima uncensoredcreampiehandjobcaribbeancom
    • 2021-03-27
    60 min

    FC2PPV 1743233 Testicle Massage ＃ 8 Kurumi Aizawa [Tokyo Hands @ Men’s Esthetics]

  • amateur uncensoredfc2
    • 2021-04-02
    58 min

    FC2PPV 1743341 [Personal shooting] Kanade 32 years old Massive launch to a sweat duck beautiful wife with outstanding style F cup beauty big tits

  • amateur uncensoredfc2
    • 2021-04-07
    120 min

    [MSA-016](Amateur Videos) (Creampie Raw Footage) 16 A Massive Semen Flood Into Her Shaved Pussy Without Permission! She Looks Just Like That Famous Gravure Idol Yuki-chan Is A 22-Year Old Colossal Tits JD! I Love Her Black Hair Bangs And Her Pigtails

  • censoredcreampieamateurMSAfuturefuture futureMSA-016MSA016
    • 2021-04-09
    117 min

    [EBOD-813]Young And Sweet Plump Bar Owner With A Thick Ass And Thighs Will Fuck For 2,000 Yen In Nishikawaguchi

  • censoredbig titsslutEBODe bodyhirokoji osakiEBOD-813EBOD813ebod00813
    • 2021-04-15
    240 min

    [NASH-494]We Heard That Out In The Country, Farm Wives Work In The Nude! What's More, They Were Down For Three- And Four-Somes And Fucking In The Open Air!

  • censoredbig titsmature womanNASHpinkjun nagasawanadeshikoNASH-494NASH494nash00494
    • 2021-05-08
    63 min

    Pacopacomama 050821_473 Mature Beauty Without Makeup: Ryu Enami

  • amateur uncensoredpacopacomama
    • 2021-05-15
    65 min

    Caribbeancom 051521-001 Soapland With Young Girl Only 11 Mitsuki Harutori

  • amateur uncensoredcreampiehandjobcaribbeancom
    • 2021-05-27
    115 min

    [JRZE-051]First Time Filming My Affair - Sayoko Ninomiya

  • sayoko ninomiya censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-051JRZE051h-086jrze00051
    • 2021-06-08
    61 min

    499NDH-022 Is The Idol Beautiful Girl JD Who Has A Fan Club banned From Love？ Only the body is OK! Inevitable love with a naive and innocent smile! The virgin juice that has been accumulated for more than 20 years is fascinated by the soft white ass!

  • amateur censoredcreampieamateurndhndh-022ndh022499ndh-022
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-19
    150 min

    [NNPJ-454]# Amateur Fan Film - This Busty F-Cup Showed Up To Model Swimsuits, But Little By Little Things Got Erotic, And Soon She Was Slipping Those Swimsuits Off To Take A Creampie - In Her Porn Debut. College Girl Riku

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-454NNPJ454nnpj00454
    • 2021-07-02
    81 min

    FC2PPV 1900433 19-year-old former idol research student. A tear in the shadow of her smile to make her dream of becoming a drama actress come true in the morning. She is a vaginal cum shot at the end of shame and humiliation. An unprecedented record

  • amateur uncensoredfc2
    • 2021-07-02
    120 min

    [JUL-637]I Can't Become A Gentleman - Nao Jinguji

  • jinguji temple nao censoredmature womansingle workJULmadonnainaballJUL-637JUL637jul00637
    • 2021-07-03
    61 min

    H0930 tk0037 Sakino Taketani 32years old

  • amateur uncensoredh0930
    • 2021-07-06
    58 min

    C0930 ki210706 Yoshino Sasahara 39years old

  • amateur uncensoredc0930
    • 2021-07-06
    46 min

    188HINT-0466 Yuki

  • amateur censoredcreampiesquirtinghinthint-0466hint0466188hint-0466
    • 2021-07-09
    101 min

    [shinki-047]M47ちゃん

  • amateur censoredcreampieamateurshinkishinki-047shinki047shinki-047
    • 2021-07-14
    44 min

    Caribbeancom 071421-001 The Undisclosed: Hand Job, Standing 69, Beauty’s Ejaculation Technique! Shino Aoi, Rino Sakuragi, Ren Miyamura

  • amateur uncensoredhandjobcaribbeancom
    • 2021-07-23
    120 min

    [KSBJ-148]Domestic affair Shiori Tsukada

  • shiori tsukada censoredbig titssingle workKSBJksb kikaku emmanuellebito sakuraKSBJ-148KSBJ148ksbj00148
    • 2021-07-28
    60 min

    Caribbeancom 072821-001 Quick Shooting: The Best Of Momoka Ogawa Momoka Ogawa

  • momoka ogawa uncensoredcreampiehandjobcaribbeancom
    • 2021-07-30
    59 min

    [WKD-044]Provocative Interview Room. Ruka Inaba.

  • inaba censoredbig titsblowjobWKDwaap entertainmentk westwWKD-044WKD0442wkd00044
    • 2021-08-12
    223 min

    [DANDY-774]Mature Massage Parlor Therapist With Big Tits Shakes Curvy Ass Doing Cowgirl On A Guy"s Hard-on While He"s Completely Locked Down

  • kimishima mio honami akagi censoredbig titsslutDANDYdandytanaka baconDANDY-774DANDY7741dandy00774
    • 2021-08-20
    167 min

    [CAWD-269]Fucked Over 500 Guys! Former S*****t Council President Who Is Smart But Incredibly Dirty Lets Loose! Fulfilling All Of Her Desires With Endless Orgasms Special Mirai Horinaka

  • horinaka mirai censoredcreampiebeautiful girlCAWDkawaiiinnabarCAWD-269CAWD269cawd00269
    • 2021-09-04
    244 min

    [KSBJ-154]Her Tits Jiggle In Cowgirl, 60 Big Tits Hotties

  • mizuna wakatsuki shiori tsukada censoredbig titsKSBJksb kikaku emmanuelleKSBJ-154KSBJ154ksbj00154
    • 2021-10-02
    51 min

    C0930 hitozuma1364 Miharu Nozaki 33years old

  • amateur uncensoredc0930
    • 2021-11-11
    112 min

    [GUN-864]Incontinent Deep Throat: Alice Otome

  • otsu alice censoredbig titssquirtingGUNradixsakuraba kyuu kokoro otokobatsugunGUN-864GUN864433gun00864
    • 2021-11-15
    56 min

    230OREC-933 Kazuna (Kazuna Yuki)

  • amateur censoredcreampiebig titsorecorec-933orec933230orec-933
    • 2021-11-19
    214 min

    [REXD-390]The Tables Have Turned! Panty Thief Caught By A Security Guard: "Let"s See You Get Your Clothes Off!"

  • censoredcreampieblowjobREXDredmanji groupREXD-390REXD390rexd00390
    • 2021-11-20
    90 min

    355OPCYN-204 Ruru (Ruru Cha.)

  • amateur censoredcreampiesquirtingopcynopcyn-204opcyn204355opcyn-204
    • 2021-11-24
    117 min

    459TEN-027 [Ultimate De M Trance] No Extra Foreplay, Null Foreplay! !! With Full Throttle, H Cup Beauty Caregiver Is Squid! !! !! The Back Of The Throat Is Violated, The Neck Is Strangled, And The Abnormal Cum Is Repeated While Blowing The Tide! !! !

  • amateur censoredbig titsamateurtenten-027ten027459ten-027
    • 2021-12-03
    118 min

    [NNPJ-484]Eager And Easygoing - Immediate Blowjob - Abrupt Raw Fucking - Creampie Loads Are Okay! Lewd Posting On Social Media With G-cup Big Tits. Gal On Social Media - Picking Up Girls. Licking, Fondling, And Shaking While This Girl Gets Fucked For

  • censoredcreampiebig titsNNPJnampa japanNNPJ-484NNPJ484nnpj00484
    • 2021-12-14
    480 min

    [KTRA-360]Beautiful Girl Imouto 10 People Continuous Sex Vol.9 8 Hours 2 Discs

  • nana kiyozuka jun kawaguchi censoredcreampiebeautiful girlKTRAk tribeKTRA-360KTRA360h-094ktra00360
    • 2021-12-17
    170 min

    [PPPD-985]I Spent A Week In A Tsundere Life Together With The Unfriendly Big Tits Elder Sister Type Who Lives Next Door Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPDoppaiPPPD-985PPPD985pppd00985



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies