body




FC2MVSDATIDGMEMHNDADNSQTEAVSASANWAAAMILKCHRVBBANRBDSSISVENUMIAAIPXHZGDABWSDAB

2024-02-16
150 min

EBWH-072 My Brother"s Wife"s Physical Beauty Is Too Attractive... Aphrodisiac Is Mixed With Protein And A Strong Woman"s Body Is Confirmed To Be Pregnant, Creampie Sex Maria Chihaya

  • chihaya maria censoredcreampiebig titsEBWHe bodytrendy yamaguchiEBWH-072EBWH072ebwh00072
    • 2024-02-15
    81 min

    FC2-PPV 4307754 *Limited Time*[Husband Official Species NTR] Hapbar Regular*Too Strong Beautiful Wife 30 Years Old.De M Is Opened In 3p 3P !!

  • amateur uncensoredcreampiemarried woman
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-15
    124 min

    YOCH-008 A 60-year-old Mother Who Sacrificed Her Body And Even Had Her House Taken Over In Order To Repay Her Son"s Debt. Azusa Mayumi

  • azusa mayumi censoredcreampiemature womanYOCHcenter villageyoichi sanotaoyuanYOCH-008YOCH008h-086yoch00008
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-14
    51 min

    FC2-PPV 4306057 ★Half Price Until 2/25 [Uncensored/Complete Amateur] Finally Consent To Creampie! A Tsundere Girl With A Marshmallow Body Who Came Three Times Because She Was Charmed By His Extremely Thick Dick Got Excited By The Raw Penetration Whil

  • amateur uncensoredcreampieamateur
    • 2024-02-14
    63 min

    259LUXU-1775 Luxury TV 1761 100 Pure And Neat! Active Female Voice Actor Appears In AV! Moe-like Moaning Voice Overflowing From A Body With Outstanding Sensitivity! An Appearance To Learn Acting Turns Into Facial Sex With Professional Techniques!

  • amateur censoredbig titsamateurluxuluxu-1775luxu1775259luxu-1775
    • 2024-02-13
    94 min

    FC2-PPV 4305108 G-cup Soft And Strongest Breasts ♡ Current Role Large ◯. Raw Big Breasts And A Spoiled Child ♡ She Is My Precious Sex Friend With A Cute And Fluffy Personality ♪ If My Body Is Found Out, My Position Will Be In Danger, So I Might Delet

  • amateur uncensored
    • 2024-02-13
    72 min

    107STZY-011 Nanao Saizuki (21), A College Student With A Naughty Body Who Was Aiming To Become A Nursery Teacher

  • satsukinanao censoredbig titsamateurstzystzy-011stzy011107stzy-011
    • 2024-02-13
    43 min

    fc2-ppv 4304632 Limited To 3 Days! 70 OFF! ! [First Shot] [Facial Appearance] Divine Breast Style! ! Squirting On My Face! ？ After That, Gakuburu! Serious Soft Body Sex That Starts With Facial Squirting And Ends With Facial Cumshot. FC2-PPV-4304632

  • amateur uncensoredamateur
    • 2024-02-12

    fc2-ppv 4287318 First Photoshoot And Face Showing! ! Limited To 3 Days! ! She Grew Up As A Small Girl And Has Spent Her Adolescence Hiding Her Gender Identity Disorder Until Now. After Exposing Her Immature Body Outdoors And Humiliating Her, She Ejac

  • amateur uncensored
    • 2024-02-11
    43 min

    fc2-ppv 4300903 Until 2/13 [Ⅰcup Beauty] Market Price 300 Million Yen Breasts 102cm! Beauty Loved By God, Anime Body Given By The Devil (21) A Miraculous Amateur Couple"s Raw Creampie Personal Video FC2-PPV-4300903

  • amateur uncensoredcreampieamateur
    • 2024-02-11
    93 min

    MAAN-952 [Fascinating G Cup Body] Outdoor Bath Shooting With Former Gravure Idol! Without A Blowjob → Change Into A Yukata And Switch Offense And Defense! Tied Both Hands And Toyed And Cunnilingus! I Coated Her With Oil And Thrusted Hard From Behind!

  • amateur censoredcreampiebig titsmaanmaan-952maan952maan-952
    • 2024-02-11
    63 min

    SIRO-5201 A Beautiful Older Sister With A Cute Smile Applied For An AV Out Of Curiosity! She Plays With Her Frustrated Body And Squirts A Lot In Front Of The Camera! ! Once She Gets Used To It, She Takes Turns Attacking And Defending, Licking The Man

  • amateur censoredbig titssquirtingsirosiro-5201siro5201siro-5201
    • 2024-02-10
    63 min

    200GANA-2990 In The Sex Room Of A Seasoned Pick-up Artist, We Secretly Filmed Her For Sex 335 Take Home A Tall, Small-faced Girl With A Model Body! I Have A Sensitive Constitution That Makes Me Cum Right Away Even Though I Say "I"m Embarrasse

  • amateur censoredamateurganagana-2990gana2990200gana-2990
    • 2024-02-10
    85 min

    MAAN-951 [Beautiful Butt Pianist Who Can"t Stop The Divine Symphony] A Pervert Singer-songwriter Who Has A Neat Appearance But Is Actually A Chubby Guy Plays And Sings With Fun! ？ Smooth Beautiful Legs X Obscenely Shaped Erotic Butt BODY! A Piani

  • amateur censoredcreampiesquirtingmaanmaan-951maan951maan-951
    • 2024-02-10
    49 min

    021024_01 Amateur AV Interview ~A Plump Body That Will Listen To Anything~

  • akemi tezuka uncensoredcreampieamateur
    • 2024-02-10
    66 min

    fc2-ppv 4300592 [Face Exposed] Mika-chan, A Former Model With A 172 Cm 8 Head And Fair Skin, Super Slender And Beautiful Body. My Beloved Boyfriend Has A Penchant For Cuckolding, So I Allow My Body To Be Held By A Stranger, And I Am Allowed To Have A

  • amateur uncensored
    • 2024-02-09
    150 min

    443BANK-159 Creampie Open-air Hot Spring Slutty Squirting Girl With An Erotic Body

  • amateur censoredcreampiebig titsbankbank-159bank159443bank-159
    • 2024-02-09
    73 min

    300NTK-850 [Maximum Service Of A Beautiful F Breasts P Active Girl! ! 】 [Top Of Plump Beauty Who Prioritizes Pleasure Over Money] [Gorgeous Sexual Intercourse] P Activity Of A Beautiful Woman With A Supple Curved Erotic Body And An Innocent Look! ! O

  • amateur censoredcreampieamateurntkntk-850ntk850300ntk-850
    • 2024-02-09
    61 min

    HEYZO-3253 Nako Nagase [Nako Nagase] The Brush Has The Best Body! Vol.3

  • nako nagase uncensoredcreampiemarried woman
    • 2024-02-09
    70 min

    FC2-PPV 4297305 Glossy Black-haired Mika (20) I Thoroughly Observed Her Slender Body, Inserted Her Cat Ear Cosplay, And Forced Her To Spread And Suck. Insertion 3 Times Creampie 2 Times FC2-PPV-4297305

  • amateur uncensoredcreampieuniform
    • 2024-02-08
    34 min

    FC2-PPV 4295484 [No] While I Was Leaving My Children. She Can"t Stop Going Wild With Her Voluptuous Body. Apply Oil To A Married Woman. Excited Creampie With Jiggling Big Tits And Too Big Big Ass [Limited Time Early Purchase Bonus Included] FC2-P

  • amateur uncensoredcreampieamateur
    • 2024-02-08
    119 min

    NSM-053 Aphrodisiac Oil Massage Molester Voyeur & Creampie Amateur Girl VOL.53 A Woman Who Was Unknowingly Smeared With A Massage Oil Containing A Super Strong Aphrodisiac During The Treatment Was Surprised By Her Body"s Flushing And Was Confused

  • ena satsuki kanna misaki censoredcreampieNSMnishi shinjuku massage main officeaphrodisiac massageNSM-053NSM053h-1342nsm00053
    • 2024-02-08
    64 min

    fc2-ppv 4295372 Limited To 3 Days! 70 OFF! ! [First Shot] [Facial Appearance] The Highest Peak! ! Mischievous Breasts Given By God. 1 Out Of 1000 People Have Slender And Explosive Anime Breasts! ! Enjoy The Real Fuji Mine◯ Body To Your Satisfaction.

  • amateur uncensoredcreampieamateur
    • 2024-02-08
    77 min

    HEYZO-3273 Yukari [Yukari] Amateur Young Wife"s Lewd Body A Sensitive Housewife Who Takes Off Her Clothes To Earn Some Pocket Money

  • yukari uncensored
    • 2024-02-07
    81 min

    MFC-279 Developed Sensitive Portio X Shrimp Warped Slender Body [MoA(OL)] A Stimulating Sightseeing Date In Tokyo With A Local Girl In A Long-distance Relationship/Simultaneous Cum In Both The Stomach And Inside With Double Portio Torture/Ecstatic Co

  • amateur censoredcreampieamateurmfcmfc-279mfc279mfc-279
    • 2024-02-07
    58 min

    fc2-ppv 4290847 [Monashi] Dedicated To 49,907 Followers [Perika"s Best In History] Ideal Beauty Body *We Want Everyone To Enjoy The Overwhelmingly Transparent Pure BODY, So We Offer It At A Low Price* FC2-PPV-4290847

  • amateur uncensoredcreampieamateur
    • 2024-02-07
    66 min

    COSX-055 Even Though She Is A Beginner In Individual Photography, I Taught K-chan, Who Has Huge Breasts, J Cup, And A Lewd Body, The Best Part Of Individual Photography, ``seeding Photo Session.""

  • censoredcreampiebig titsCOSXuncle pacohame taking uncleCOSX-055COSX055cosx00055
    • 2024-02-06
    60 min

    020624_01 Amateur AV Interview ~ 95 Cm Big Breasted Erotic Body That Came To Earn Some Money To Be Able To Play While Traveling Abroad

  • megumi matsui uncensoredcreampieamateur
    • 2024-02-06
    48 min

    FC2-PPV 4289183 [Uncensored] [Footjob] A D-cup Beauty With Long Legs And A Toned Body. A Former Idol"s Slender Boinboin Female Hole Is Made To Cum. She Gets Creampied By A Creepy Old Man. FC2-PPV-4289183

  • amateur uncensoredcreampie
    • 2024-02-06
    47 min

    FC2-PPV 4289049 [No] To Escape From My Domestic Violence Husband... A Married Woman With Two Children Who Had Reached Her Mental And Physical Limits Offered Her Ripe Body In Order To Receive Financial Support. FC2-PPV-4289049

  • amateur uncensoredcreampiemarried woman
    • 2024-02-05
    66 min

    FC2-PPV 4286554 *One Week Only* [Highest Alc Content In History 13!!] A 28-year-old Alcoholic With Huge Breasts. The Strongest Can Crush And Ascend To The Demon World Conscious Mud Slut Sensual Choroman Fuck!! [Insanity] FC2-PPV-4286554

  • amateur uncensoredcreampieamateur
    • 2024-02-05
    97 min

    fc2-ppv 4287317 [2 Works] Rina-chan Has A Super Sensitive Constitution That Makes Her Squirt. Let"s Have A Drink And Enjoy The Raw Sex. A Fair-skinned Slender Body With A Beautiful Waist And A Beautiful Ass Gets Creampied 3 Times. FC2-PPV-4287317

  • amateur uncensored
    • 2024-02-04
    139 min

    MAZO-041 Serious Idol Class! Real JD 21 Years Old <<Domasochist Training>> The Camera Is Turned By A Pervert Man And The Loli Bra"s Body Is Continuously Cummed. Meat Slave ● Beseeches Tsuruman Creampie

  • censoredcreampieMAZOhmn worksamateur shiba tarokanMAZO-041MAZO041h-1472mazo00041
    • 2024-02-04
    31 min

    FC2-PPV 4284222 [Individual] The Wife Of A Strong Former Bank Hostess Regularly Sacrifices Her Body To Maintain A Peaceful Life, And Her Emotions Become Paralyzed By The Situation. FC2-PPV-4284222

  • amateur uncensoredcreampiemarried woman
    • 2024-02-03
    151 min

    KTB-079 The Lewd Older Sister Is Back! Even If The Sperm Dries Up, I Won"t Let It Go, My Older Sister And I Fuck Each Other, And My Younger Brother"s Sex Makes Her A Stupid Last Holiday Yuuri Kirika

  • kirika yuuri censoredsistersingle workKTBlower body tigers delusion groupfuyoka hawksKTB-079KTB079ktb00079
    • 2024-02-03
    64 min

    SIRO-5193 [Whole Body Erogenous Zones] A Shy And Sensitive College Student Appears! The Whole Body"s Erogenous Zones Are Not Just For Show! No Matter Where I Touch It, It Feels Twitchy. She Makes Her Cute Eyes Moist Like A Small Animal And Cums O

  • amateur censoredamateursirosiro-5193siro5193siro-5193
    • 2024-02-03
    110 min

    ANB-231 I Go Crazy With The Lewdness Of My Beautiful And Naughty Aunt"s Slender Body, Akane Morita

  • morita benion censoredsingle workANBrubysusumu yanoguchinobleANB-231ANB231anb00231
    • 2024-02-03
    120 min

    YMDD-366 A Married Woman"s Business Trip Feeling That Is Rumored On The Street. A Mature Delivery Of Sensual Sensations That Confuses Men. The H-cup Fluffy Body That Appears At The Door Is A Greedy Slutty Wife Maya Kikuchi Who Cums All Over The P

  • kikuchi maya censoredcreampiesingle workYMDDmomotaro video publishingteam pine angelsyoung peachYMDD-366YMDD366ymdd00366
    • 2024-02-03
    125 min

    KTB-078 Female Boss Likes Nipples! A Female Boss Who Loves Playing With Her Nipples Has A Teasing Ejaculation Office.My Female Boss: Sakura-san, Misaki Sakura.

  • cape sakura censoredslutsingle workKTBlower body tigers delusion groupnadeshiko japanKTB-078KTB078ktb00078
    • 2024-02-02
    146 min

    MIDV-577 Sweaty, Intersecting Body Fluids, 100 Million Yen Body With Repeated Orgasms, Intense Intertwined Single-minded Sex Mitsuki Momota

  • momota mitsuki censoredbeautiful girlslutMIDVmoody stake dmoodyz divaMIDV-577MIDV577midv00577
    • 2024-02-02
    150 min

    FPRE-014 Asuna (21) Appears In AV With A Bright And Gentle Smile And A Plump Body That You"ll Want To Hold Forever. First Creampie SEX! Asuna Hoshi

  • asuna hoshi censoredcreampiebeautiful girlFPREfitchdazai chinpopreciousFPRE-014FPRE014fpre00014
    • 2024-02-02
    160 min

    LULU-274 I Couldn"t Resist The Beauty Of My Childhood Friend"s Muscular Body, And When I Got An Erection, He Showed Me His Big Thong Butt And Gave Me A Hand Job And Fellatio, Forcing Me To Train Him To Squeeze Out My Cum Over And Over Again.

  • chanyota censoredcreampiesingle workLULUlunaticsnagases wingLULU-274LULU274lulu00274
    • 2024-02-02
    120 min

    FPRE-015 Former Reader Model With G Cup Soft Body Creampie Ban Released! Mitsuha Nonose"s First Experience Of 3 Very Orgasms

  • nonose mitsuha censoredcreampiesingle workFPREfitchmichiru arashiyamapreciousFPRE-015FPRE015fpre00015
    • 2024-02-02
    60 min

    FC2-PPV 4280655 [Uncensored] Invincible Smile! Explosion Into The Mouth With Little Experience Of Blowjobs! First Shot Of Misa-chan, The No. 1 Whitening Body. FC2-PPV-4280655

  • amateur uncensoredcreampieblowjob
    • 2024-02-02
    240 min

    NKM-005 Beautiful Body That You Want To Insert Every Day 4 Super Lewd Beauty SPECIAL 10 People 4 Hours

  • censoredcreampiebig titsNKMthis is it laymanNKM-005NKM005h-1631nkm00005
    • 2024-02-02
    190 min

    FPRE-011 Old Man"s Gonzo Documentary - Sweaty Sexual Intercourse With Rich And Sticky Body Fluids - Shiori Minami

  • minami shiori censoredcreampiesingle workFPREfitchdazai chinpopreciousFPRE-011FPRE011fpre00011



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies