blowjob censored nampa amateur high vision




FC2NACRCJODABWVENUAUKGHODVHZGDAUKSHDKASPRDMILKADNAVSAWAAAMEYDMIAACAWDBBANFSDSSSSIS

2021-01-09
119 min

[EBOD-794]Swapping Stepsisters - "I'll Let You Grope My Stepsister's Big Tits If You Do The Same For Me!" - 2 Girls And 2 Guys Fuck Like Monkeys In The Summer Countryside - Yukino Nagisa, Ruka Inaba

  • yukino nagi inaba censoredcreampiebig titsEBODe bodyxavier thomas 2EBOD-794EBOD794ebod00794
    • 2021-01-11
    39 min

    362SCOH-024 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Thu ● Honzakura]

  • amateur censoredcreampieamateurscohscoh-024scoh024362scoh-024
    • 2021-01-12
    126 min

    [GONE-026]This Lovey-Dovey Slut Is An Unattainable Flower She's Domesticating This Chubby NEET Nerd Loser Piece-Of-Shit Motherfucker Like A Stray Cat.

  • censoredcreampiebig titsGONEmercurya fair skinned elder sisterGONE-026GONE026h-1133gone00026
    • 2021-01-19
    139 min

    [STARS-323]Mana Is A Beautiful Lady Boss Who Hates My Guts, And I Can't Abide By That, So I'm Going To Send Her To A Massage Parlor And Have Her Converted To Fit My Tastes! Mana Sakura

  • mana sakura censoredbig titssingle workSTARSsod createryo inugamisod starSTARS-323STARS3231stars00323
    • 2021-01-24
    66 min

    SIRO-4403 [First shot] [Peeking from a miniskirt ..] [Gachi shy cum] A slender beauty who is agitated by shame and sighs. Grabbing her quivering waist .. Application amateur, first AV shooting 185

  • amateur censoredamateursirosiro-4403siro4403siro-4403
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    76 min

    FC2PPV 1678932 [No x Semi-outside Creampie] ★ Naughty ★ After having fun at the amusement park, have sex at the inn …!？ “Personal shooting”

  • amateur uncensoredfc2
    • 2021-02-20
    97 min

    [IMOTA-008]I Tried To Make My Nerdy Loser Stepsister A Little Sexier And She Transformed Into A Raging Slut. Aria Aimi

  • aimi censoredblowjobsisterIMOTAstar paradisesister eggIMOTA-008IMOTA008h-254imota00008
    • 2021-02-22
    61 min

    JRAI-006 Mine-based girls Yuririn

  • amateur censoredamateurjraijrai-006jrai006479jrai-006
    • 2021-02-22
    98 min

    [QRDF-008]SM Queen Road VOL.43 - Yuria

  • censoredanalQRDFqueen roadQRDF-008QRDF008qrdf00008
    • 2021-03-19
    120 min

    [GNAB-050]If You Go To A Sauna On A Weekday When There's Not Many Customers, There's A Pretty Good Chance You Can Have Sex With The Ladies Who Work There 2

  • censoredcreampiemarried womanGNABprestigebang prestigeGNAB-050GNAB050118gnab00050
    • 2021-03-26
    120 min

    [WAAA-049]The Goddess Of Sweet Blowjobs Flight Attendant Loves To Suck Dick! She Sucks Up Cum With Her Wild Vacuum Blowjobs Rui Natsuki

  • rui hizuki censoredbig titsblowjobWAAAones factorywanzWAAA-049WAAA049waaa00049
    • 2021-03-26
    148 min

    [EKAI-021]Full Cumshot! A Ball-squeezing Wife

  • chitose in the evening censoredbig titssquirtingEKAIwaap entertainmentgoro koenjicobra warpEKAI-021EKAI0212ekai00021
    • 2021-04-15
    108 min

    [DDFF-009]A Horny Bunny Slut With Hard Nipples FXXKING BUNNY Himari Kinoshita

  • himari kinoshita himari hanazawa censoredslutsingle workDDFFdogmafk 2DDFF-009DDFF009ddff00009
    • 2021-04-17
    133 min

    [DASD-854]Pretending To Be Seduced And Mercilessly Fucking! Devilish Teacher Ravishes The Moody S*****t President Nanase Asahina

  • asahina nanase censoredcreampieuniformDASDdaschinpo dazaiDASD-854DASD854dasd00854
    • 2021-04-19
    98 min

    [PRBYB-073]An Adorable Body Sayaka Otoshiro

  • censoredbig titsbeautiful girlPRBYBprecious beautyPRBYB-073PRBYB073h-706prbyb00073
    • 2021-05-01
    118 min

    [SSIS-053]Big Titty Y********l Who Works At A Bar In The Country Side Has Nothing To Do But Party And Have Sex After She Misses The Last Train Miharu Hanesaki

  • miharu hanasaki censoredbig titsblowjobSSISs1 no 1 stylekitorune kawaguchiSSIS-053SSIS053ssis00053
    • 2021-05-19
    49 min

    396 BIG-104 Risa

  • amateur censoredcreampieschoolgirlbigbig-104big104396big-104
    • 2021-05-21
    56 min

    509JPAK-011 Arisa 2

  • amateur censoredbig titsuniformjpakjpak-011jpak011509jpak-011
    • 2021-05-22
    96 min

    FC2PPV 1830409 Celebration! The 4th 1st Anniversary Appreciation Project! 2980PT → 1980PT [Beautiful wife NTR with no individual shooting, outflow, 〇Snow very similar] Called a beautiful mom model with SEX-less and cheating habit at work and conceive

  • amateur uncensoredfc2
    • 2021-05-28
    124 min

    [ECB-145]I Love My Teacher So Much I Could Eat Him Up Erina Oka

  • hill erina censoredschoolgirlsingle workECBwaap entertainmentikkyu sencobra warpECB-145ECB1452ecb00145
    • 2021-06-22
    33 min

    FC2PPV 1881701 [No] [Face lifted] Finally! !! Overwhelming beautiful girl! Thorough dissection from the corner of the body to the shape of the pussy with private vaginal cum shot SEX ♡

  • amateur uncensoredfc2
    • 2021-06-25
    48 min

    HEYZO 2565 POV Fuck Option With Rookie Call Girl Plus Creampie For Free – Miss Deli Yuka

  • derijyouyuka uncensoredheyzo
    • 2021-06-26
    122 min

    [ITSR-093]This Old Lady Is Serious. At First She Laughed And Said, "Don't Tease Me!" But Then She Seemed To Be In The Mood For Some Real Sex!？ In The End, Even Though She Was An Old Bitch, I Seriously Had Creampie Sex With Her!？ 7 Shimasa

  • censoredcreampieamateurITSRbig morkalitadakiITSR-093ITSR09357itsr00093
    • 2021-07-01
    110 min

    [AMBI-131]A Horrible Stepdad's Sex Toys: A Beautiful Y********l In Uniform Had Her Relationship With Her Boyfriend Destroyed - Remu Hayami

  • remi hayami censoredcreampieschoolgirlAMBIplanet plusdirector oanbibarentsuAMBI-131AMBI131h-237ambi00131
    • 2021-07-03
    57 min

    C0930 ki210704 Maho Shibata 20years old

  • amateur uncensoredc0930
    • 2021-07-09
    67 min

    FC2PPV 1913342 [Uncensored] Completely fallen into S slut and beautiful nail technician Misa-chan in a flashy highleg! De S face sitting and rich raw vaginal cum shot SEX !!: Nail technician (19 years old) ④

  • amateur uncensoredfc2
    • 2021-07-13
    61 min

    521MGFX-007 Excavation ☆ Breast Milk Amateur 1

  • amateur censoredcreampieschoolgirlmgfxmgfx-007mgfx007521mgfx-007
    • 2021-07-13
    61 min

    Caribbeancom 071321-001 A beautiful office lady who is addicted to a manual labor man: Refresh with a strong cock on the way home from work Ema Kato

  • ema kato uncensoredcreampiehandjobcaribbeancom
    • 2021-07-19
    37 min

    FC2PPV 1927642 [Individual Shooting 46] Complete Appearance 21 Years Old Jd Streak Pie Bread D Cup Cleaning Blowjob From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-07-20
    30 min

    FC2PPV 1932265 [No] [Limited To 100 Pieces 2980 → Off To 1480pt!] A Famous Reading Mode Finalist! Advent Again ♥ ️ Massive Vaginal Cum Shot! !! ♥ ️ * Review Benefits / High Image Quality Ver.

  • amateur uncensoredfc2
    • 2021-07-22
    120 min

    [MIAA-477]Female Detective Sneaks In As A Decoy! Aphrodisiac Oil Bondag With Endless Orgasms Version Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-477MIAA477miaa00477
    • 2021-08-17
    76 min

    H4610 ki210817 Himari Miyake 24years old

  • amateur uncensoredh4610
    • 2021-08-20
    89 min

    [HIKR-188]Surf Girl With Big Tits And Ass Gets Picked Up In L.A. And Makes Her Porn Debut By Straddling A Man With Her Obscene Dynamite Body Shaking Hard Violet (23)

  • censoredcreampiebig titsHIKRhikara delusion grouphollywood saburoHIKR-188HIKR188hikr00188
    • 2021-09-10
    81 min

    HEYZO 2628 Creampie in America #Kyler2 – Kyler

  • kyler uncensoredheyzo
    • 2021-09-17
    123 min

    [FOCS-020]Undiscovered Talent In Hakata! The 171cm Luxuriously Slender And Pure Beautiful Girl. A Lewd Sexual Extravaganza That Goes For 1 Night And 2 Days Without Sleep. Haru Yamaguchi

  • yoko yamaguchi censoredblowjobsingle workFOCSabc mousou zokufocusFOCS-020FOCS020focs00020
    • 2021-10-01
    121 min

    [MIAA-509]I Develop My Devil Little Stepsister"s Ass And Make Her Cum

  • tsukino luna censoredslutsisterMIAAmoodyzminna no kikatanMIAA-509MIAA509miaa00509
    • 2021-10-01
    160 min

    [CAWD-288]A Sweetly Sadistic Beautiful Y********l In Uniform Who Loves B.B. Boys Incessantly And Will Shut Down Your Reasonable Mind Through Nipple Teasing Yumeru Kotoishi

  • yume kotoishi censoreduniformslutCAWDkawaiikc takedaCAWD-288CAWD288cawd00288
    • 2021-10-08
    105 min

    [VENX-081]上京した息子と月に1度の遠距離相姦 今月もまた私はあの子に抱かれに行く―。 紗々原ゆり

  • yuri sasahara censoredcreampiemature womanVENXvenuskitano majimeincest vi nasuVENX-081VENX081venx00081
    • 2021-10-15
    147 min

    [MIRD-214]A Golden Shower Harlem I Want These 4 Beautiful Girl Babes To Spray Me With Their Piss And Make Me Cum, Over And Over Again! Runa Tsukino Asuka Momose Yui Nagase Hikaru Minazuki

  • tsukino luna momose asuka censoredcreampiesquirtingMIRDmoodyzdoragon nishikawamoodyz realMIRD-214MIRD214mird00214
    • 2021-11-11
    160 min

    [MIST-355]Tokyo Nipple Girl Yurika Aoi Who Controls Ejaculation, Squirting, Female Ecstasy, And Pleasure By Skilled Nipple Play.

  • yurika censoredsquirtingmature womanMISTmr michirurassha miyoshiMIST-355MIST3551mist00355
    • 2021-11-12
    60 min

    FC2PPV 2427234 * Until 11/14 2980⇒1980 ★ First Appearance ★ Gorgeous Beauty Celia With High Aesthetic Awareness 25-Year-Old Is In Agony With Dense Playbate Gonzo ♥ Plump Sexy Body ♥ Creampie With Squirrel ♥ * There Is A Privilege

  • amateur uncensoredfc2
    • 2021-11-18
    52 min

    H4610 ki211118 Miyabi Mori 28years old

  • amateur uncensoredh4610
    • 2021-12-09
    44 min

    230OREV-003 Ria (21)

  • amateur censoredcreampiebig titsorevorev-003orev003230orev-003
    • 2021-12-10
    62 min

    328HMDN-434 Mana (Aina Shinkawa)

  • amateur censoredcreampiebig titshmdnhmdn-434hmdn434328hmdn-434
    • 2022-01-01
    122 min

    [XVSR-629]Perfect Rearing. Stocking. Confinement. 24 Hours. Ichika Mogami

  • ichibana mogami hana sato censoredsingle workXVSRmax ak c takedacalenXVSR-629XVSR629xvsr00629
    • 2022-01-02
    47 min

    188HINT-0500 Saori 2

  • amateur censoredbig titsmarried womanhinthint-0500hint0500188hint-0500
    • 2022-01-08
    214 min

    [BAZX-323][Completely Subjective] Let"s Have Ovulation Day Impregnation Sex with a Beautiful Maid Girl Who Allows Immediate Fellatio and Sex vol. 003

  • mao watanabe marina saito censoredcreampieblowjobBAZXbazookatodoBAZX-323BAZX323bazx00323



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies