matsumoto ichika




FC2NGODMEYDVENXHNDKBILULUMIAANATRAUKSFSDSSAWDNACRAVSADASDWAAASANMIDVEBODBLKMIDE

2020-10-08
39 min

[gerk-315]まいちゃん

  • amateur censoredcreampieschoolgirlgerkgerk-315gerk315gerk-315
    • 2020-10-17
    82 min

    421OCN-017 Emachan

  • amateur censoredamateurocnocn-017ocn017421ocn-017
    • 2020-10-22
    93 min

    [OKZ-012]A Divine Mature Woman A Fifty-Something Babe Who Hasn't Been Getting Any Lately Mitsuko 52 Years Old She's Working A Sexy Part-Time Job, And She's Keeping It A Secret From Her Husband And K*ds The Last Time She Got Fucked Was Yea

  • mitsuko ueshima censoredcreampiemature womanOKZdaddy s private photosno directorgodly mature womanOKZ-012OKZ0121okz00012
    • 2020-10-24
    57 min

    FC2PPV 1544919 GA-Walk Whis Yu & Misa & Yukopi XX walk or tag with fans I met in the city？

  • amateur uncensoredfc2
    • 2020-10-25
    68 min

    [jrai-003]ななみ

  • amateur censoredamateurjraijrai-003jrai003jrai-003
    • 2020-11-14
    76 min

    200GANA-2385 Seriously Nampa, first shot. 1552 H cup daughter who wants to be an actress jets tide with a piston! !! !! Erotic SEX such as writhing while shaking the huge breasts! !! !!

  • amateur censoredbig titssquirtingganagana-2385gana2385200gana-2385
    • 2020-11-27
    239 min

    [MGT-127]Erotic Cosplay Relay Baton vol. 02

  • censoredcreampieamateurMGTprestigemegatraMGT-127MGT127118mgt00127
    • 2020-12-05
    55 min

    H4610 ki201206 Rina Tachikawa 26years old

  • amateur uncensoredh4610
    • 2020-12-21
    126 min

    [GENM-065]This Massage Parlor Slut Made Me Ejaculate Using Her Amazing Techniques Amy Fukada

  • emi fukada censoredsluthandjobGENMgenekifukadaGENM-065GENM065genm00065
    • 2021-01-01
    200 min

    [FCH-070]Exclusive - When She Breaks Out Her Sexy Tongue Techniques And Deep Kisses You While She's Giving You A Handjob, You Know It's Time To Cum! 5

  • ichika matsumoto kira ri censoredbeautiful girlhandjobFCHprestigefetish partyFCH-070FCH070118fch00070
    • 2021-01-02
    78 min

    [opcyn-140]ゆりあ 3(28)

  • amateur censoredbig titsamateuropcynopcyn-140opcyn140opcyn-140
    • 2021-01-04
    42 min

    FC2PPV 1632103 [Personal shooting] No.026 Yuka-chan ★ A cute beautiful girl with black hair. I am very excited about Jubojubo Blow and violent hip swing ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2021-01-10
    29 min

    FC2PPV 1640085 [Amateur] Twitter back dirt girls! 19-year-old D cup female college student and immediate Gonzo [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-24
    135 min

    [CESD-971]A Married Woman Swimming Instructor With A Banging Hot Body Yuno-san (29 Years Old) She's A Perverted Cunt Who Wants To Bathe In Enough Rich And Thick Semen To Drown Her Yuno

  • censoredmature womanbukkakeCESDceleb no tomoCESD-971CESD971cesd00971
    • 2021-01-24
    178 min

    [CESD-968]Nene Tanaka's Colossal Tits & Big Booty Bounce For Cowgirl Sex 4

  • nene tanaka censoredbig titsmature womanCESDceleb no tomoCESD-968CESD968cesd00968
    • 2021-02-05
    59 min

    [ZOZO-050]Aoi Morinaga

  • censoredZOZOsadie willenauZOZO-050ZOZO0501zozo00050
    • 2021-02-11
    187 min

    [NHDTB-491]2 Holes Creampie Group Sex Bus

  • censoredanalcreampieNHDTBnatural highjanken kotamaNHDTB-491NHDTB4911nhdtb00491
    • 2021-02-12
    141 min

    [FONE-134]She Needed The Cash: Tall, Busty Model With An Hourglass Figure - This College Girl Looks Barely Legal.

  • censoredcreampiebig titsFONEfirstplusFONE-134FONE134h-491fone00134
    • 2021-02-14
    61 min

    HEYZO 2458 Having Lovely Time With A Big Tits Amature Gril – Mai Maruyama

  • mai maruyama uncensoredcreampieheyzo
    • 2021-02-17
    240 min

    [OVG-164]Clitoral Suction Vibrator Masturbation - Make Your Clit Happy! With Both Suction And Vibration Functions, Watch These Porn Stars' O-Faces Light Up With Orgasmic Ecstasy In A Way You've Never Seen Before 15 Girls, 240 Minutes

  • yuri sugawa wakamiya censoredslutOVGglory questOVG-164OVG16413ovg00164
    • 2021-02-20
    88 min

    FC2PPV 1693696 Please enjoy yourself. 14980 → 9980

  • amateur uncensoredfc2
    • 2021-02-22
    111 min

    [KSAT-033]A Seriously Cute And Tall J* Bitch Gets Seduced For Creampie Sex She's In The Design Department Of *** School Nana 170cm Tall

  • censoredcreampieuniformKSATstrong woman s table daydream tribesix mantable of a strong womanKSAT-033KSAT033ksat00033
    • 2021-02-24
    77 min

    453SSAN-018 Runa-chan

  • amateur censoredbig titsamateurssanssan-018ssan018453ssan-018
    • 2021-02-27
    62 min

    200GANA-2438 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 191 Bring your cute erotic sister to the spear room and enjoy sweet sex like a lover! Carefully caress and supple body, quivering and feeling!

  • amateur censoredamateurganagana-2438gana2438200gana-2438
    • 2021-03-05
    480 min

    [DRC-024]Raw Amateur Videos Leaked 07

  • censoredcreampiebig titsDRCprestigedocument recordDRC-024DRC024118drc00024
    • 2021-03-27
    80 min

    491TKWA-063 A Noh Weather Girl’s Minimum Female College Student Who Says "If You Have Fun In Life, It’s okay!"

  • amateur censoredcreampieamateurtkwatkwa-063tkwa063491tkwa-063
    • 2021-03-27
    144 min

    [JKSR-485](Leaked Video) S********ls - Sports Training Camp Sex 2 - Sex, Night Visits, Ravished In A Three-Some, Baths, Peeping On Change Rooms... Totally Naughty Footage

  • censoredcreampieschoolgirlJKSRbig morkalprink junkyJKSR-485JKSR48557jksr00485
    • 2021-04-13
    168 min

    [MSFH-057]Bodies And Souls Overflowing With Kindness Girl With Fluffy H-Cup Tits And A Healing Aura Makes Her Porn Debut Fuwari Hino

  • hino fluffy censoredbig titssingle workMSFHsod createkyoseims sodMSFH-057MSFH0571msfh00057
    • 2021-04-20
    92 min

    [KCK-011]Livestock Transsexual 11 Pure Masochistic Slut Is Transformed Into A Woman Churin

  • chuzawa nakazawa censoredbdsmKCKsanwa publishingclick manKCK-011KCK011h-019kck00011
    • 2021-04-22
    142 min

    [IESM-058]Rina Takase She's Lifting Her S&M And Creampie Pregnancy Fetish Ban And Beginning Her Breaking In Training

  • rina takase censoredcreampieschoolgirlIESMienergykikuriniesmIESM-058IESM0581iesm00058
    • 2021-05-01
    63 min

    SIRO-4505 [First shot] [Innocent girl] [Natural H cup daughter] A shy and pure active college student participates in the war. While she was listening to the story, she was attracted to her charm and took off her cute clothes .. AV application on the

  • amateur censoredbig titsamateursirosiro-4505siro4505siro-4505
    • 2021-05-08

    H4610 ori1755 Ayuka Oto 21years old

  • amateur uncensoredh4610
    • 2021-05-21
    155 min

    [CJOD-297]My Two Younger Step Sisters Look Down On Me For Being A NEET And Tease Me With Condescending Dirty Talk And Show Me Their Panties Ichika Matsumoto Yui Nagase

  • ichika matsumoto yui nagase censoredcreampiebeautiful girlCJODchijo heavenham the mcCJOD-297CJOD297cjod00297
    • 2021-06-04
    238 min

    [HUNTB-028]"I Never Knew You Were So Horny - You're Soaking Wet!" "Says The One Who Just Popped Wood!" What Would Happen If You Watched Porn With Your C***dhood Friend

  • censoredcreampieschoolgirlHUNTBhuntervolvo nakanohhh groupHUNTB-028HUNTB028huntb00028
    • 2021-06-07
    56 min

    FC2PPV 1857725 [3480 → Limited number 2480] 20-year-old concafe beauty with anime voice ❤️ Gestures are very cute ❤️ Girls K students No panties No bra sailor suit forbidden Saddle shooting ❤️ Rich mass cum shot with raw insertion ❤️

  • amateur uncensoredfc2
    • 2021-06-16
    150 min

    [BLK-503]This Sugar Baby Doesn't Normally Like Older Guys, But When This Hung DILF Pounds Her Hard She Loves Every Minute! "His Dick Was So Droopy... Now It's Rock Hard!

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-503BLK503blk00503
    • 2021-06-18
    60 min

    230OREC-791 Mayu

  • amateur censoredcreampiebig titsorecorec-791orec791230orec-791
    • 2021-06-26
    120 min

    [JBJB-023]高身長女子vsおじさんチ●ポ 長い脚とねっとり舌技で中年ザーメン絞り取るよ～ 森日向子

  • hinako mori censoredbeautiful girlsingle workJBJBsharkjabujabu machiJBJB-023JBJB023h-687jbjb00023
    • 2021-06-29
    44 min

    274DBL-0101 It may be JD in the middle of intercrural sex ~ Insert raw raw Hiyori 21 years old

  • amateur censoredamateurbeautiful girldbldbl-0101dbl0101274dbl-0101
    • 2021-07-03
    47 min

    C0930 hitozuma1358 Yuika Yoshikata 26years old

  • amateur uncensoredc0930
    • 2021-07-09
    189 min

    [MUDR-155]All it Takes are Fantasies to Get Me Wet... Beautiful Girl Desires Bondage and Training in Masochism. Ai Kawana.

  • ai kawana censoredcreampiebdsmMUDRmukuMUDR-155MUDR155mudr00155
    • 2021-07-24
    141 min

    [JUKF-065]I Was Told To Go To My Teacher's House For Tutoring, Rena-chan, Rena Aoi

  • blue censoredcreampiebeautiful girlJUKFjumpjump avJUKF-065JUKF065h-227jukf00065
    • 2021-08-12
    58 min

    FCP-034 [Delivery Only] Instead Of Angry Waves, Double Facial Cumshots! !! The Limit To Squeeze Until Empty!

  • amateur censoredamateurslutfcpfcp-034fcp034fcp-034
    • 2021-08-13
    117 min

    [PPPD-950]I Lost Reason Because Of My S*****t"s Big Tits And Creampie Fucked Karen Again And Again In A Love Hotel. Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPDoppaiPPPD-950PPPD950pppd00950
    • 2021-09-07
    480 min

    [KTRA-329]Precocity! Sex With My Younger Stepsister Who Has Big Tits, A Compilation Of 10 Girls, 8 Hours, 2-DVD Set

  • shiho egami airi sato censoredbig titsbeautiful girlKTRAke toraibuk tribeKTRA-329KTRA329h-094ktra00329
    • 2021-09-17
    120 min

    [EYAN-176]Young Housekeeper With Plump Butt Got Me Hard! I Fucked Her Every Time She Came To My House Seta Ichika

  • kazuhana seta censoredbig titsblowjobEYANe bodyhasami kukahanazakari no tsumatachiEYAN-176EYAN176eyan00176
    • 2021-09-21
    120 min

    [SAN-020]I Let The Delivery Man Have Sex With My Wife. A Plan Of A Husband Who Has ED (Erectile Dysfunction). Miu Narumi

  • narumi miu censoredcreampiesingle workSANmazakisakura kabinmother mazaSAN-020SAN020h-796san00020



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies