enami




FC2GMEMVENUSTARSNGODDASDBBANJUFENATRAVSAAUKSSHKDNACRMVSDMARAWAAASQTEATIDNACXKSBJABW

2020-10-18
120 min

[AQSH-059]Stuck Up Big Booty Housewife Next Door Gave Me Attitude, So I Seduced Her Into Becoming My Very Own Sex Toy! Kanae Kawahara

  • kanae kawahara censoredcreampiemature womanAQSHaquamall herowhite moleaquamallAQSH-059AQSH059aqsh00059
    • 2020-10-25
    34 min

    279UTSU-461 Yu

  • amateur censoredmarried womanamateurutsuutsu-461utsu461279utsu-461
    • 2020-11-20
    89 min

    [KYUN-002](For Streaming Editions) # Heart Pounding Thrills 002/Saeko/19 Years Old/College S*****t

  • censoredcreampieamateurKYUNprestigekyunKYUN-002KYUN002118kyun00002
    • 2020-11-21
    65 min

    [tkwa-132]まこ＆さや

  • amateur censoredcreampieschoolgirltkwatkwa-132tkwa132tkwa-132
    • 2020-11-26
    486 min

    [FERAX-008]This Is What Happened When I Fed My Stepmom Some Aphrodisiacs... My Friend From Class Got His Hands On This Illicit Potion, And So I Fed It To My Stepmom, Who Had Long Since Lost Her Allure As A Woman, And That Got Her Seriously In The Moo

  • censoredcreampiemarried womanFERAXcenter villageparadise center villageFERAX-008FERAX008h-086ferax00008
    • 2020-11-29
    114 min

    [BIJN-190]The Documentary Basic Instinct-Baring Orgasmic Sex A Newlywed Young Wife And Her Lover Are Awakening Their Lust Through G*******ging Mind-Blowing Creampie Pleasure Riho Fujimori

  • riho fujimori censoredcreampiesingle workBIJNbijin majo emmanuelleBIJN-190BIJN190bijn00190
    • 2020-12-03
    40 min

    FC2PPV 1593134 [rematch! ] Mechakawa JD-chan’s nice ass butt oil slimy raw SEX! It feels so good that I feel like I’m peeing It’s getting better www

  • amateur uncensoredfc2
    • 2020-12-12
    166 min

    [MIAA-359]High Class Soapland Specialized In Creampies - Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsMIAAmoodyzhirokoji osakieveryone s porn starMIAA-359MIAA359miaa00359
    • 2020-12-15
    245 min

    [NPS-406]Real Pickup! Will You Punch My V-Card, Please？ They Forget The Camera's Running At The Chance For Creampie Sex With A Hot Male Virgin - 81 Orgasms! 15 Loads!

  • censoredcreampiesquirtingNPSpetersken kikuchinampaNPS-406NPS406h-021nps00406
    • 2021-01-06
    67 min

    [sika-008]のぞみ＆めぐ

  • amateur censoredcreampieschoolgirlsikasika-008sika008sika-008
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-25
    30 min

    FC2PPV 1659473 [Personal shooting] Unfaithful act of a 26-year-old young wife with an erotic plump body ①

  • amateur uncensoredfc2
    • 2021-02-03
    54 min

    FC2PPV 1671179 Limited time [Uncensored] Supporting a big tits cafe manager, continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-05
    50 min

    [YMDS-018]First Time Amateur Shots Documental: Can't Let An Amateur Of The Highest Class Get Away (Himari, 24)

  • censoredcreampieamateurYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-018YMDS018ymds00018
    • 2021-02-05
    240 min

    [FIV-076]***** 5-Star Channel A Glamorous Lady Special Ch.53 A Still-Growing Beautiful Girl Shows Off Her Glamorous And Cute Body In An Alluring 240 Minutes!

  • censoredbig titssquirtingFIVprestigefive starsFIV-076FIV076118fiv00076
    • 2021-02-07
    240 min

    [MMB-348]Head Over Heels For Curvy, Soft, Squishy, Bouncy Marshmallow Bodies - 4 Hours

  • kina shinozaki shizuka omori censoredcreampieMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-348MMB348mmb00348
    • 2021-02-19
    131 min

    [ONSG-032]Big Titted Prostitute - Rui Miura

  • rui miura censoredcreampiebig titsONSGgain corporationONSG-032ONSG032onsg00032
    • 2021-03-05
    57 min

    FC2PPV 1708261 [Personal shooting] First shot copulation of beautiful breasts Sara (22 years old)! A new teacher is absorbed in sex for the first time in 5 months and panting

  • amateur uncensoredfc2
    • 2021-03-06
    239 min

    [HUNTA-960]"Please Stop! I'm Cumming So Much I Think I'm Going To Lose My Mind!" My Little Stepsister Was Thrusting Out Her Tight, Godly Ass, And I Could No Longer Resist ... So I Entered Her Raw, From Behind! And Then I Pumped Her Wi

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-960HUNTA960hunta00960
    • 2021-03-18
    56 min

    C0930 ki210318 Mitsuko Hayama 43years old

  • amateur uncensoredc0930
    • 2021-03-26
    60 min

    [WFR-014]Horny Babe On Her Way Home From Work With A Wet Pussy Cums Hard Hazuki Wakamiya

  • wakamiya censoredbig titssquirtingWFRwaap entertainmenttonkatsuwWFR-014WFR0142wfr00014
    • 2021-04-03
    240 min

    [YLWN-161]"Your Dick Is So Hard" Videos Of Working Older Women Giving Handjob And Blowjobs 25 Women 4 Hours

  • censoredbig titsmature womanYLWNyellow moonpappan tateishiYLWN-161YLWN161ylwn00161
    • 2021-04-14
    64 min

    FC2PPV 1768763 [NTR] Cheating wife: A de M married woman who is completely obedient to an S macho man and is squid by becoming a female dog

  • amateur uncensoredfc2
    • 2021-04-23
    145 min

    [MIAA-429]Filming Seemingly Innocent Footage Of A Skinny Big Titty Girl Who Wants To Become A Celebrity Arisa Takanashi

  • takanashi arisa censoredcreampiebig titsMIAAmoodyzkyoseieveryone s porn starMIAA-429MIAA429miaa00429
    • 2021-04-24
    120 min

    [BIJN-198]The Documentary Orgasmic Basic Instinct-Baring Sex This Soft And Puffy H-Cup Titty Big Tits Babe Is Having A Horny, Lusty Orgy Fuck Fest Nene Tanaka

  • nene tanaka censoredbig titssingle workBIJNbijin majo emmanuelleBIJN-198BIJN198bijn00198
    • 2021-05-10
    120 min

    [TENX-21051]Faded Beauty Average Age Of Actresses = 54.7 Years Old

  • censoredmarried womanamateurTENXtennin xTENX-21051TENX21051h-1542tenx21051
    • 2021-05-15
    61 min

    1Pondo 051521_001 Seducing by Flashing Pussy: Miyu Morita

  • amateur uncensored1pondo
    • 2021-05-20
    181 min

    [OFKU-182]This Colossal Tits Housewife Had Voluptuous, Big Saggy Tits, And She Fell For His Young Cock As They Engaged In Creampie Sex 180 Minutes

  • censoredbig titsmature womanOFKUstar paradisemom railOFKU-182OFKU182h-254ofku00182
    • 2021-06-10
    189 min

    [PIYO-118]"I Want My Step Dad's Baby!" The Love Between A Small Step Daughter And Her Step Father Leads To Raw Sex...

  • censoredcreampiePIYOhyokopiero daPIYO-118PIYO1181piyo00118
    • 2021-06-16
    238 min

    [HUNTB-036]"Please, Stop! I'm Going To Lose My Mind From All These Orgasms!" Virgin Pounds His Bratty Stepsister!

  • censoredcreampieschoolgirlHUNTBhuntervolvo nakanohhh groupHUNTB-036HUNTB036huntb00036
    • 2021-07-06
    141 min

    [KIRE-049]A Beautiful Woman Has Daydream Fantasies (Of Being Fucked To Orgasmic Glory) She's Getting The Deepest Nether Regions Of Her Womb Relentlessly And Continuously Pumped, As She Twitches And Throbs To Massive Orgasmic Ecstasy! A Currently

  • hinano okada censoredsquirtingsingle workKIREsod createdainanabeauty kirei sodKIRE-049KIRE0491kire00049
    • 2021-07-08
    119 min

    [SPRD-1435]Best Aunt Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1435SPRD143518sprd01435
    • 2021-07-14
    251 min

    [SSIS-161]A Previously Unreleased Premium Edition! Pleasure! First Experiences 8 We'll Show You Plenty Of Saika Having Plenty Of Sex 3 Fucks A 240-Minute Special Saika Kawakita

  • ayaka hebei censoredbeautiful girlsingle workSSISs1 no 1 stylekyoseiSSIS-161SSIS161ssis00161
    • 2021-07-22
    110 min

    [FSDSS-253]I Went On A Business Trip And Got Booked Into The Same Hotel Room With My Lady Boss. She Scolded Me And Pussy-Pounded 10 Cum Shots Out Of Me Until The Break Of Dawn Minori Kawana

  • real village henan censoredcreampieblowjobFSDSSfalenomanyufaleno starFSDSS-253FSDSS2531fsdss00253
    • 2021-07-31
    239 min

    [MLSM-049]S Class Mature Woman Best Of Reiko Kobayakawa 4 Hours Big Tits And Nice Ass Madonna

  • kobayakawa reiko censoredcreampiebig titsMLSMmellow moonMLSM-049MLSM049mlsm00049
    • 2021-08-06
    240 min

    [MUKD-465]Erotic Services Offered In Gym Clothes! Mouths, Hands, Thighs, And Ass-Jobs Will Make You Feel Bliss, Plus Tons Of Cum Bukkake On School Gym Shorts - 10 Beautiful Teens, Deluxe Edition With Bonus Footage, 4 Hours

  • marina saito takanashi arisa censoredblowjobbeautiful girlMUKDinnocentMUKD-465MUKD465mukd00465
    • 2021-08-21
    242 min

    [NASH-556]Four Hour Collection Of Rural Stepmothers Engaging In Dramatic Forbidden Sex. Six Different Chubby, Middle Age Women Envelope Their Stepsons With Enormous Breasts

  • shigeko nagata satoshi kondo satomi kondo censoredmature womanNASHnadeshikoNASH-556NASH556nash00556
    • 2021-09-17
    177 min

    [PRED-335]Ex Local Broadcast Announcer Gets More Worked Up Than Usual For Horny Older Guys. 3 Scenes Of Full-on Fucking. Sakura Yoda

  • sakura yoda censoredslutsingle workPREDpremiumkyouseielegancePRED-335PRED335pred00335
    • 2021-09-24
    331 min

    [HUNTB-107]I Ended Up Dating My Little Stepsister, Who Is Very Bashful But Super Cute... And When Our Parents Were Away For The First Time For 2 Days And A Night... It Was Our Chance To Fuck! So We Were Fucking All Day, From Morning Until Night! 4

  • censoredcreampieschoolgirlHUNTBhunterborubo nakanohhh groupHUNTB-107HUNTB107huntb00107
    • 2021-09-24
    238 min

    [OFJE-331]"I Want You To Feel More And More Pleasure, With My Tits!!" A Super Pleasurable Rush Of Pre-Ejaculatory Titty Fuck Joy 100 Cum Shots, In All Their Titty Fucks & Breast-Splattering Glory! 3

  • anzai rara miharu hanasaki censoredbig titsblowjobOFJEs1 no 1 styleOFJE-331OFJE331ofje00331
    • 2021-10-15
    154 min

    [MIDE-982]194 Furious Orgasms! 3826 Pussy Spasms! 16792cc Of Serious Bodily Fluid Sprays! An Abstinence-Teasing Massive Orgasmic Awakening Special!! - 30 Days Of Pent-Up Lust Were Explosively Released In One Single Day - Ru Yumemi

  • dream censoredbig titsbeautiful girlMIDEmoodyzmonmoodyz divaMIDE-982MIDE982mide00982
    • 2021-10-15
    150 min

    [PRED-345]A Triple Slut Office Lady Harlem Threat Horny Elder Sister Types Will Hit You With A 3-Point Combo And Make You Creampie Cum, Over And Over Again! Kano Kashii Yui Hatano Himari Kinoshita

  • kashii hanano yui hatano censoredcreampieblowjobPREDpremiumkyouseielegancePRED-345PRED345pred00345
    • 2021-10-18
    91 min

    HHW-002 Kanna (Hirai Kanna)

  • amateur censoredbig titsamateurhhwhhw-002hhw002hhw-002
    • 2021-11-01
    121 min

    [NACR-473]Mother In Heat, Nanao Nakano

  • nanao nakano censoredcreampiebig titsNACRplanet plusdirector oshichi ku ryuuNACR-473NACR473h-237nacr00473
    • 2021-11-04
    135 min

    [TOEN-054]Kyoka Kano 41-Years Old. Innocent Wife With Overflowing Smiles Makes Porn Debut Without Telling Husband!

  • kyoka kano censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-054TOEN054h-086toen00054
    • 2021-11-11
    203 min

    [NHDTB-596]A Video Of A Woman Who Was Married To A Senior Colleague And Had Her Sexually Axxaulted While On Duty.

  • censoredcreampiebig titsNHDTBnatural highsakurai baniraNHDTB-596NHDTB5961nhdtb00596
    • 2021-11-11
    81 min

    [IENF-176]Sexual Feelings Of Sensitive Girls At An Oil Massage Parlor 2

  • karen anba himari ayase censoredcreampieIENFie nergyienfIENF-176IENF1761ienf00176
    • 2021-11-11
    127 min

    [HBAD-601]When I Went To Visit My Relatives After A Long Absence, My Sister, Who Had Grown Into A Big Tit, Innocently Seduced Me With No Bra And No Protection Nanami Matsumoto

  • nana matsumoto censoredbig titssingle workHBADhibinorokutanzono seishibabeHBAD-601HBAD6011hbad00601



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies