arai




FC2KSBJSQTEAUKSAUKGVEMASHKDAPODIPXHNDSPRDNACRPPPDAVSADASDSTARSFSDSSMIDVMEYDJULVENX

2020-02-14
151 min

[MDBK-085]Baby Treatment Mankai!! "Your Home Is A Nursery School" A Big Tits Nursery School Delivery Health Call Girl Service That Will Baby You To Orgasmic Ecstasy

  • aki erie arai erie yuka osawa misono waka censoredcreampiebig titsMDBKmedia stationmaso knifebazookaMDBK-085MDBK08561mdbk00085
    • 2020-02-08
    159 min

    [IPX-437]She's Lifting Her Ban! Super Active At The Club! This Former Dance Group Member Is Filming Her First Creampie Raw Footage Fuck Fest Sex Scenes Maron Natsuki

  • marin natsuki censoredcreampieblowjobIPXidea pocketzaku araidishIPX-437IPX437ipx00437
    • 2020-02-01
    121 min

    [PRED-215]The Last Day Of A Business Trip - Sharing A Room With My Female Boss - She Rides Me Cowgirl Style And I Creampie Her Until Morning - Erii Akira

  • aki erie arai erie yuka osawa censoredcreampiesingle workPREDpremiumsapporo taroelegancePRED-215PRED215pred00215
    • 2020-02-01
    119 min

    [SSNI-695]She's So Nice That She Gets Hustled For A Real Fuck!! F Cup Jiggly Titty Bar Girl Nodoka Sakuraba

  • sakuraha nodoka censoredbig titscosplaySSNIs 1 number one stylezack arais1 no 1 styleSSNI-695SSNI695ssni00695
    • 2020-01-25
    116 min

    [MIDE-732]Heart-Pounding First Time - A Woman With Big Tits Performs Soapland Services - Fumika Nakayama

  • nakayama fumika censoredbig titssingle workMIDEmoody szack araimoodyz divaMIDE-732MIDE732mide00732
    • 2020-01-20
    129 min

    [GMEM-004]The Insane T*****e Research Center Reborn: The Madness The Sad Elegy Of A Naughty And Haughty Young Lady Lawyer Who Was Brought Down In Dripping, Squirting Lust Elly Akira

  • aki erie arai erie yuka osawa censoredsquirtingbdsmGMEMavs collector sbaba za babbyavscollector sGMEM-004GMEM004gmem00004
    • 2020-01-19
    150 min

    [CJOD-223]The World Of Dry Orgasms, Where You'll Encounter The Divine Domain Of Cumming Like A Bitch During Her Usual Masturbation, Filled With Glops Of Semen - First Class MANIAX Edition - Elly Akira

  • aki erie arai erie yuka osawa censoredslutCJODslut havennanzaki masakiCJOD-223CJOD223cjod00223
    • 2020-01-19
    118 min

    [HND-778]A Soapland Where They'll Let You Fuck The Girls Bareback And Creampie Them As Many Times As You Like - Ena Koume

  • ena koume censoredcreampiebig titsHNDbookzack araiHND-778HND778hnd00778
    • 2020-01-19
    132 min

    [DASD-623]An Idol With Big Tits Gets Fucked And Brainwashed - She Tries To Resist, But She Gets Turned Into A Naughty Slut - Eimi Fukada, Eri Akira

  • emi fukada aki erie arai erie yuka osawa censoredbig titsdramaDASDdasrokusaburo mishimaDASD-623DASD623dasd00623
    • 2020-01-16
    180 min

    [SSNI-688]Triple Cast - S1 Exclusive Beauties Appearing Together For A 3 Hour Special

  • nine yoshitaka ichika hoshimiya censoredlesbianslutSSNIs one number one stylezach arais1 no 1 styleSSNI-688SSNI688ssni00688
    • 2019-12-28
    118 min

    [SSNI-662](*Abnormally Massive Orgasms) The Greatest Eros Company Awakening! Furious Non-Stop Serious Sex Until All Lust Has Been Depleted Miharu Usa

  • miharu hanasaki censoredbig titssquirtingSSNIs1 no 1 stylezaku araiSSNI-662SSNI662ssni00662
    • 2019-12-28
    118 min

    [SSNI-664]She's Mounting This Greasy, Oily Middle-Aged Dirty Old Man And Getting Sweaty And Juicy And Shaking Her Big Ass In Voluptuous Big Butt Human Battle Piston Pumping Sex Shion Yumi

  • evening beauty censoredbig titssquirtingSSNIs1 no 1 stylezaku araiSSNI-664SSNI664ssni00664
    • 2019-12-28
    118 min

    [PRED-212]A Dignified Career Woman The Other Thing To Know About Her Is That She Is The No.1 Soapland Princess At A Soapland In The Kansai Region What A Difference! A 172cm Tall Slender Beautiful Woman Makes Her Adult Video Debut! Anne Ito

  • an ito censoredsquirtingsingle workPREDpremiumzaku araielegancePRED-212PRED212pred00212
    • 2019-12-24
    140 min

    [STARS-164]Double Super Sadist Sluts Extravagant Endless Cumshot Full Course Special!!!! Yuna Ogura Suzu Honjo

  • yuna ogura suzu honjo censoredsquirtingslutSTARSsod createzaku araisod starSTARS-164STARS1641stars00164
    • 2019-12-22
    145 min

    [JUFE-132]While My Wife Was Out Of The House On A Company Trip, I Creampie Fucked Her Beautiful Big Tits Big Sister For 5 Straight Days Of Breaking In Training, And Here Is The Video Record To Prove It Elly Akira

  • aki erie arai erie yuka osawa censoredcreampiebig titsJUFEfitchJUFE-132JUFE132jufe00132
    • 2019-12-22
    119 min

    [MIDE-722]An H-Cup Former C***d Actress Her First Follow-Up Orgasm Right After Cumming, Her Twitching And Trembling Sensual Pussy Got Follow-Up Piston-Pumping Cock Thrusts Fumika Nakayama

  • nakayama fumika censoredbig titssquirtingMIDEmoodyzzaku araimoodyz divaMIDE-722MIDE722mide00722
    • 2019-12-19
    133 min

    [DASD-611]Mom Friend Clique

  • aki erie arai erie yuka osawa ayano kato censoredbig titsdramaDASDdasnao masakiDASD-611DASD611dasd00611
    • 2019-12-19
    239 min

    [HNDS-065]The Beautiful Girl Creampie Island A 10th Anniversary Fan Appreciation Festival Special!! Ultra Super Intense Creampie Large Orgies

  • hasumi claire blue censoredcreampieblowjobHNDShon nakazampaHNDS-065HNDS065hnds00065
    • 2019-12-19
    67 min

    [REBD-433]Mio 2 Paradise Island Mio Kimijima

  • kimishima mio censoredsingle workREBDrebeccazaku araiREBD-433REBD433h-346rebd00433
    • 2019-12-14
    236 min

    [SSNI-653]Welcome To The Highest-Grade Celebrity Sex Club Apartment House The Hard And Tight Sensual Technique Of Marin Hinata A 240-Minute Full Course

  • marin hinata censoredsquirtingsingle workSSNIs1 no 1 stylezaku araiSSNI-653SSNI653ssni00653
    • 2019-12-10
    175 min

    [MSFH-001]Miko Mizusawa Porn Debut

  • mizusawa beauty censoredbig titssingle workMSFHsod createzaku araims sodMSFH-001MSFH0011msfh00001
    • 2019-12-10
    136 min

    [STARS-171]Double Sex Sluts - Tied Up And Broken In - Rough Sex Ending In Heavy Creampies - Suzu Honjo, Yuna Ogura - 16 Creampie Special!!

  • suzu honjo yuna ogura censoredcreampiesquirtingSTARSsod createzaku araisod starSTARS-171STARS1711stars00171
    • 2019-12-07
    157 min

    [MIRD-198]5 Squirting Stepsisters While Our Parents Were Away, I Got Slut Fucked And Squirted By My Horny Stepsisters...

  • aki erie arai erie yuka osawa yurika censoredbig titssquirtingMIRDmoodyzcontour stylemoodyz realMIRD-198MIRD198mird00198
    • 2019-12-07
    119 min

    [IPX-412]"Let's Be (Sex) Friends..." - My Sister-In-Law Seduced Me By Wearing No Bra And No Panties. - 10 Astonishing Scenes! - Tsubasa Amami

  • amami tsubasa censoredcreampiesingle workIPXidea pocketzaku araidishIPX-412IPX412ipx00412
    • 2019-12-07
    119 min

    [IPX-414]I Abstained From Sex For A Month, And While My Girlfriend Was Away For A Few Days, I Had So Much Fucking Sex With Her Little Sister That I Thought I Was Going To Lose My Mind 8 Fucking Fucks Total Coverage Fuck! Karen Kaede

  • karen kaede moei akebono censoredsingle workdramaIPXidea pocketzaku araidishIPX-414IPX414ipx00414
    • 2019-12-07
    178 min

    [IPX-420]Genuine Creampie Raw Footage 5 Sex Club Fucks A 180-Minute Fully Reserved Special Course Twitching And Trembling Spasmic Orgasmic Consecutive Cum Shots! 5 Furious Raw Creampie Fucking Situations! Minori Hatsune

  • hatsune minori censoredcreampiebig titsIPXidea pocketzaku araidishIPX-420IPX420ipx00420
    • 2019-12-05
    61 min

    [REBD-430]Tsubasa Colorful wings Tsubasa Amami

  • amami tsubasa censoredsingle workREBDrebeccazaku araiREBD-430REBD430h-346rebd00430
    • 2019-12-05
    66 min

    [REBD-429]Yui5 Endless evolution Yui Hatano

  • yui hatano censoredREBDrebeccazach araiREBD-429REBD429h-346rebd00429
    • 2019-11-30
    113 min

    [ADN-231]Darling, Forgive Me... - I Cheated On My Husband With His Best Friend 3 - Yuka Arai

  • yuka arai censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-231ADN231adn00231
    • 2019-11-21
    61 min

    [REBD-427]Maria 2 - Maria Of The Southern Isles - Maria Aine

  • maria aine censoredsingle workREBDrebeccazaku araiREBD-427REBD427h-346rebd00427
    • 2019-11-17
    116 min

    [JUL-043]A Windy Rainstorm I Spent The Night With My Favorite Married Woman Delivery Girl Elly Akira

  • aki erie arai erie yuka osawa censoredbig titsmature womanJULmadonnamamezawa mametaroJUL-043JUL043jul00043
    • 2019-11-17
    121 min

    [DASD-599]While I Was Away On A Business Trip For 3 Days, My Shaved Pussy Big Tits Girlfriend Got Fucked And Impregnated By My Dad Elly Akira

  • aki erie arai erie yuka osawa censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-599DASD599dasd00599
    • 2019-11-17
    118 min

    [HND-756]Pleasure/Orgasms/Semen An Orgasmic Squirting Endless Loop!! Creampie Seconds That Go On And On Until She's All Out Of Lust Elly Akira

  • aki erie arai erie yuka osawa censoredsquirtingdeepthroatHNDbookichiro kanedaHND-756HND756hnd00756
    • 2019-11-17
    120 min

    [CJOD-214]These Girls Were Secretly Assaulting Me With Their Panties And Bras Off And Luring Me To Temptation Elly Akira Yui Hatano

  • aki erie arai erie yuka osawa yui hatano censoredcreampiebig titsCJODchijo heaventrendy yamaguchiCJOD-214CJOD214cjod00214
    • 2019-11-14
    122 min

    [SSNI-629]A Sensual Slim Body Hiyori Yoshioka Hear Her Scream! Watch Her Cum! See Her Seriously Cum! A 3 First Experiences Special

  • hiyori yoshioka censoredsquirtingblowjobSSNIs1 no 1 stylezaku araiSSNI-629SSNI629ssni00629
    • 2019-11-09
    148 min

    [IPX-393]"Don't You Dare Make A Fool Out Of Me (She's Crazy)!!" The Tables Are Turned!! This Beautiful Race Queen Likes To Show A Good Face, But I Fucked The Shit Out Of Her Maron Natsuki

  • marin natsuki censoredsingle workIPXidea pocketzaku araidishIPX-393IPX393ipx00393
    • 2019-11-09
    149 min

    [MIDE-704]Ultra High-Class, Cream-pie-Connaisseur Soapland An Exclusive Special! Starring: Tsubomi

  • bud censoredcreampielingerieMIDEmoody szach araimoodyz divaMIDE-704MIDE704mide00704
    • 2019-11-05
    139 min

    [KMHR-086]A Titty Pub Girl Who Loved To Serve Her Customers Is Giving Out Free Fucks In The Pub Sana Yotsuba

  • sana yotsuba censoredbig titsamateurKMHRsod createzaku araii fell in love with youKMHR-086KMHR0861kmhr00086
    • 2019-11-02
    99 min

    [ATID-380]The Captive Secretary Crazy Comatose Fuck Yuka Arai

  • yuka arai censoredcreampiesingle workATIDattackersnabein madATID-380ATID380atid00380
    • 2019-10-26
    119 min

    [MIDE-697]The Bride's Friend Spent All Night Furiously Fucking The Groom When I Met My Wife's Friend For The First Time In Years At Our Wedding, I Remembered That She Was My First Love, And That I Had Always Been In Love With Her. Minami Hats

  • hatsukawa minami censoredblowjobbeautiful girlMIDEmoody szach araimoodyz divaMIDE-697MIDE697mide00697
    • 2019-10-22
    140 min

    [STARS-123]Mana Sakura Goes To Work For The First Time In 5 Years!! - This Members-Only Soapland Lets You Cum Inside The Girls As Many Times As You Like

  • mana sakura censoredcreampiebeautiful girlSTARSsod createzaku araisod starSTARS-123STARS1231stars00123
    • 2019-10-19
    118 min

    [HND-738]Consecutive Creampie Baths Where You Will, Definitely, Absolutely Get To Ejaculate Raw Maria Nagai

  • maria nagai censoredcreampiebig titsHNDbookzach araiHND-738HND738hnd00738
    • 2019-10-19
    106 min

    [OAE-192]ALL NUDE Marin Hinata

  • marin hinata censoredsingle workOAEaircontrolzaku araiOAE-192OAE192oae00192
    • 2019-10-12
    119 min

    [PPPD-798]My Girlfriend's Older Sister Was Luring Me To Temptation With Her Big Tits And Creampie Sex Elly Akira

  • aki erie arai erie yuka osawa censoredcreampiebig titsPPPDoppaiPPPD-798PPPD798pppd00798
    • 2019-10-06
    119 min

    [IPX-385]"How Much More Are You Going To Touch Me...？", She Said In An Embarrassed Voice - This School Girl In Uniform Can't Say No To Her Perverted Gym Teacher - Kana Momonogi

  • kana momonogi censoredbeautiful girlsingle workIPXidea pocketzach araitissueIPX-385IPX385ipx00385
    • 2019-10-06
    118 min

    [IPX-382]A Braless And Pantyless See-Thru Cosplay Outfit A Divine Idol Reflexology Salon "We Have Secret Optional Services (Fucking), As Long As You Promise To Keep This A Secret..." Kokona Yuzuki

  • yuzuki shinna censoredblowjobsingle workIPXidea pocketzach araitissueIPX-382IPX382ipx00382
    • 2019-10-06
    115 min

    [EBOD-712]Legendary Slut Actress Ellie Aki's 12-In-A-Row Creampies: Ripe Body & Skilled Sex

  • aki erie arai erie yuka osawa censoredcreampiebig titsEBODe bodyEBOD-712EBOD712ebod00712
    • 2019-10-03
    60 min

    [REBD-414]Masami7 Seventh Eden (Masami Ichikawa)

  • masami ichikawa censoredsingle workREBDrebeccazaku araiREBD-414REBD414h-346rebd00414



    • The best Jav uncensored and censored jav streaming, javhd download, jav xxx free online, japanese adult videos full movies